Q96B02 (UBE2W_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin-conjugating enzyme E2 W EC=6.3.2.19 Alternative name(s): Ubiquitin carrier protein W Ubiquitin-conjugating enzyme 16 Short name=UBC-16 Ubiquitin-protein ligase W | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 151 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Ref.7 Ref.8 Ref.9 |
| Catalytic activity | ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine. |
| Pathway | |
| Subunit structure | Homodimer. Interacts with FANCL. Interacts with STUB1/CHIP By similarity. Ref.7 Ref.10 |
| Subcellular location | Nucleus. Note: In the nucleus, colocalizes with FANCL. Ref.1 |
| Tissue specificity | Widely expressed, with highest expression in brain, liver, pancreas and heart. Ref.1 |
| Post-translational modification | Ubiquitinated in vitro in the presence of FANCL By similarity. |
| Sequence similarities | Belongs to the ubiquitin-conjugating enzyme family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96B02-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96B02-2) The sequence of this isoform differs from the canonical sequence as follows: 5-5: Q → QTTGRRVEVWFP | ||||||
| Isoform 3 (identifier: Q96B02-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLSPRGVTRARQLLPLRLWPRRSWGDGSIM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 151 | 151 | Ubiquitin-conjugating enzyme E2 W | PRO_0000232689 | ||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||
| Active site | 91 | 1 | Glycyl thioester intermediate By similarity | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLSPRGVTRARQLLPLRLWP RRSWGDGSIM in isoform 3. | VSP_042974 | ||||||||||||||||||||||
| Alternative sequence | 5 | 1 | Q → QTTGRRVEVWFP in isoform 2. | VSP_017943 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Mutagenesis | 91 | 1 | C → A: Loss of predominant nuclear localization. Ref.1 | |||||||||||||||||||||||
| Sequence conflict | 26 | 1 | N → S in BAB13883. Ref.2 | |||||||||||||||||||||||
| Sequence conflict | 45 | 1 | P → S in BAA91954. Ref.2 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Helix | 6 – 17 | 12 | ||||||||||||||||||||||||
| Beta strand | 35 – 42 | 8 | ||||||||||||||||||||||||
| Turn | 48 – 51 | 4 | ||||||||||||||||||||||||
| Beta strand | 53 – 60 | 8 | ||||||||||||||||||||||||
| Turn | 62 – 66 | 5 | ||||||||||||||||||||||||
| Beta strand | 70 – 76 | 7 | ||||||||||||||||||||||||
| Helix | 93 – 95 | 3 | ||||||||||||||||||||||||
| Turn | 96 – 98 | 3 | ||||||||||||||||||||||||
| Helix | 105 – 115 | 11 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, characterization and subcellular localization of a gene encoding a human Ubiquitin-conjugating enzyme (E2) homologous to the Arabidopsis thaliana UBC-16 gene product." Yin G., Ji C., Wu T., Shen Z., Xu X., Xie Y., Mao Y. Front. Biosci. 11:1500-1507(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF CYS-91. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Embryo, Hippocampus and Placenta. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Urinary bladder. |
| [7] | "Mechanistic insight into site-restricted monoubiquitination of FANCD2 by Ube2t, FANCL, and FANCI." Alpi A.F., Pace P.E., Babu M.M., Patel K.J. Mol. Cell 32:767-777(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH FANCL. |
| [8] | "The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines." David Y., Ziv T., Admon A., Navon A. J. Biol. Chem. 285:8595-8604(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "UBE2W interacts with FANCL and regulates the monoubiquitination of Fanconi anemia protein FANCD2." Zhang Y., Zhou X., Zhao L., Li C., Zhu H., Xu L., Shan L., Liao X., Guo Z., Huang P. Mol. Cells 31:113-122(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "Structure of the human hypothetical protein LOC55284, a novel homodimeric ubiquitin conjugating enzyme." Structural genomics consortium (SGC) Submitted (SEP-2005) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.82 ANGSTROMS) OF 1-117, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY948289 mRNA. Translation: AAY24555.1. AK001873 mRNA. Translation: BAA91954.1. AK021735 mRNA. Translation: BAB13883.1. AK024050 mRNA. Translation: BAB14800.1. AK295792 mRNA. Translation: BAG58613.1. CR457275 mRNA. Translation: CAG33556.1. CH471068 Genomic DNA. Translation: EAW87009.1. CH471068 Genomic DNA. Translation: EAW87011.1. AC022826 Genomic DNA. No translation available. BC016326 mRNA. Translation: AAH16326.1. | ||||||||||||
| IPI | IPI00029300. IPI01018247. | ||||||||||||
| RefSeq | NP_001001481.2. NM_001001481.2. NP_001257944.1. NM_001271015.1. NP_060769.4. NM_018299.4. | ||||||||||||
| UniGene | Hs.128841. Hs.718604. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q96B02. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q96B02. 63 interactions. | ||||||||||||
| MINT | MINT-1428082. | ||||||||||||
| STRING | 9606.ENSP00000397453. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q96B02. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74751754. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q96B02. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 55284. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000419880; ENSP00000397453; ENSG00000104343. ENST00000517608; ENSP00000428813; ENSG00000104343. | ||||||||||||
| GeneID | 55284. | ||||||||||||
| KEGG | hsa:55284. | ||||||||||||
| UCSC | uc003xzv.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55284. | ||||||||||||
| GeneCards | GC08M074692. | ||||||||||||
| HGNC | HGNC:25616. UBE2W. | ||||||||||||
| HPA | HPA045161. | ||||||||||||
| MIM | 614277. gene. | ||||||||||||
| neXtProt | NX_Q96B02. | ||||||||||||
| PharmGKB | PA142670657. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5078. | ||||||||||||
| HOGENOM | HOG000233453. | ||||||||||||
| HOVERGEN | HBG063308. | ||||||||||||
| KO | K10688. | ||||||||||||
| OMA | FTGDNIP. | ||||||||||||
| OrthoDB | EOG49CQ8W. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96B02. | ||||||||||||
| Bgee | Q96B02. | ||||||||||||
| CleanEx | HS_UBE2W. | ||||||||||||
| Genevestigator | Q96B02. | ||||||||||||
| GermOnline | ENSG00000104343. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.10.110.10. 1 hit. | ||||||||||||
| InterPro | IPR000608. UBQ-conjugat_E2. IPR016135. UBQ-conjugating_enzyme/RWD. [Graphical view] | ||||||||||||
| Pfam | PF00179. UQ_con. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF54495. UBQ-conjugat/RWD-like. 1 hit. | ||||||||||||
| PROSITE | PS00183. UBIQUITIN_CONJUGAT_1. False negative. PS50127. UBIQUITIN_CONJUGAT_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | UBE2W. human. | ||||||||||||
| EvolutionaryTrace | Q96B02. | ||||||||||||
| GenomeRNAi | 55284. | ||||||||||||
| NextBio | 59442. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UBE2W_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96B02 Secondary accession number(s): B4DIV1 Q9NV07 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
