Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96AX2 (RAB37_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras-related protein Rab-37
Gene names
Name:RAB37
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length223 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Interacts with RIMS1 By similarity.

Subcellular location

Cytoplasmic vesicle. Note: Secretory granules By similarity.

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96AX2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96AX2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT
Isoform 3 (identifier: Q96AX2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96AX2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.5
Chain2 – 220219Ras-related protein Rab-37
PRO_0000121249
Propeptide221 – 2233Removed in mature form Potential
PRO_0000370828

Regions

Nucleotide binding36 – 438GTP By similarity
Nucleotide binding85 – 895GTP By similarity
Nucleotide binding143 – 1464GTP By similarity
Motif59 – 679Effector region By similarity

Amino acid modifications

Modified residue21N-acetylthreonine Ref.5
Modified residue2201Cysteine methyl ester Potential
Lipidation2191S-geranylgeranyl cysteine By similarity
Lipidation2201S-geranylgeranyl cysteine By similarity

Natural variations

Alternative sequence1 – 6868MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2.
VSP_041268
Alternative sequence1 – 3030MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3.
VSP_043155
Alternative sequence32 – 6837Missing in isoform 4.
VSP_043156
Natural variant1881A → P.
Corresponds to variant rs34215331 [ dbSNP | Ensembl ].
VAR_034434

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2007. Version 3.
Checksum: 5A7A4887BCBB84A8

FASTA22324,815
        10         20         30         40         50         60 
MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK DGAFLSGTFI 

        70         80         90        100        110        120 
ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY RDAQALLLLY DITNKSSFDN 

       130        140        150        160        170        180 
IRAWLTEIHE YAQRDVVIML LGNKADMSSE RVIRSEDGET LAREYGVPFL ETSAKTGMNV 

       190        200        210        220 
ELAFLAIAKE LKYRAGHQAD EPSFQIRDYV ESQKKRSSCC SFM 

« Hide

Isoform 2 [UniParc].

Checksum: 5EBF94A735395D58
Show »

FASTA21624,169
Isoform 3 [UniParc].

Checksum: 151A1E30411A53B6
Show »

FASTA22825,663
Isoform 4 [UniParc].

Checksum: 728BB40C23162B5F
Show »

FASTA18620,894

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
Tissue: Thalamus, Thymus and Trachea.
[2]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Prostate.
[5]"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 2-11, ACETYLATION AT THR-2.
Tissue: Platelet.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
RefSeqNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1.
NP_001157462.1. NM_001163990.1.
NP_783865.1. NM_175738.4.
UniGeneHs.351413.

3D structure databases

ProteinModelPortalQ96AX2.
SMRQ96AX2. Positions 26-192.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid130604. 4 interactions.
IntActQ96AX2. 2 interactions.
MINTMINT-1485128.
STRING9606.ENSP00000376389.

PTM databases

PhosphoSiteQ96AX2.

Polymorphism databases

DMDM20139581.

Proteomic databases

PaxDbQ96AX2.
PRIDEQ96AX2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
GeneID326624.
KEGGhsa:326624.
UCSCuc002jlk.3. human. [Q96AX2-1]
uc010dfu.3. human. [Q96AX2-2]
uc010wrc.2. human. [Q96AX2-3]
uc010wre.2. human. [Q96AX2-4]

Organism-specific databases

CTD326624.
GeneCardsGC17P072666.
HGNCHGNC:30268. RAB37.
HPAHPA051858.
MIM609956. gene.
neXtProtNX_Q96AX2.
PharmGKBPA134901093.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1100.
HOGENOMHOG000233968.
HOVERGENHBG009351.
KOK07914.
OMADSYQGGA.
PhylomeDBQ96AX2.
TreeFamTF323428.

Gene expression databases

ArrayExpressQ96AX2.
BgeeQ96AX2.
CleanExHS_RAB37.
GenevestigatorQ96AX2.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamPF00071. Ras. 1 hit.
[Graphical view]
PRINTSPR00449. RASTRNSFRMNG.
SMARTSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR00231. small_GTP. 1 hit.
PROSITEPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRAB37. human.
GeneWikiRAB37.
GenomeRNAi326624.
NextBio96706.
PROQ96AX2.
SOURCESearch...

Entry information

Entry nameRAB37_HUMAN
AccessionPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
Entry history
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM