SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96AX2

- RAB37_HUMAN

UniProt

Q96AX2 - RAB37_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ras-related protein Rab-37

Gene
RAB37
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi36 – 438GTP By similarity
Nucleotide bindingi85 – 895GTP By similarity
Nucleotide bindingi143 – 1464GTP By similarity

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW

GO - Biological processi

  1. protein transport Source: UniProtKB-KW
  2. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-37
Gene namesi
Name:RAB37
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:30268. RAB37.

Subcellular locationi

Cytoplasmic vesicle
Note: Secretory granules By similarity.

GO - Cellular componenti

  1. endoplasmic reticulum-Golgi intermediate compartment Source: UniProtKB
  2. secretory granule Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134901093.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 220219Ras-related protein Rab-37PRO_0000121249Add
BLAST
Propeptidei221 – 2233Removed in mature form Reviewed predictionPRO_0000370828

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine1 Publication
Lipidationi219 – 2191S-geranylgeranyl cysteine By similarity
Modified residuei220 – 2201Cysteine methyl ester Reviewed prediction
Lipidationi220 – 2201S-geranylgeranyl cysteine By similarity

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiQ96AX2.
PaxDbiQ96AX2.
PRIDEiQ96AX2.

PTM databases

PhosphoSiteiQ96AX2.

Expressioni

Gene expression databases

ArrayExpressiQ96AX2.
BgeeiQ96AX2.
CleanExiHS_RAB37.
GenevestigatoriQ96AX2.

Organism-specific databases

HPAiHPA051858.

Interactioni

Subunit structurei

Interacts with RIMS1 By similarity.

Protein-protein interaction databases

BioGridi130604. 4 interactions.
IntActiQ96AX2. 2 interactions.
MINTiMINT-1485128.
STRINGi9606.ENSP00000376389.

Structurei

3D structure databases

ProteinModelPortaliQ96AX2.
SMRiQ96AX2. Positions 26-192.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi59 – 679Effector region By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1100.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
KOiK07914.
OMAiHVLHKTI.
PhylomeDBiQ96AX2.
TreeFamiTF323428.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK    50
DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY 100
RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE 150
RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD 200
EPSFQIRDYV ESQKKRSSCC SFM 223
Length:223
Mass (Da):24,815
Last modified:January 23, 2007 - v3
Checksum:i5A7A4887BCBB84A8
GO
Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

Show »
Length:216
Mass (Da):24,169
Checksum:i5EBF94A735395D58
GO
Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):25,663
Checksum:i151A1E30411A53B6
GO
Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.

Note: No experimental confirmation available.

Show »
Length:186
Mass (Da):20,894
Checksum:i728BB40C23162B5F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti188 – 1881A → P.
Corresponds to variant rs34215331 [ dbSNP | Ensembl ].
VAR_034434

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. VSP_041268Add
BLAST
Alternative sequencei1 – 3030MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. VSP_043155Add
BLAST
Alternative sequencei32 – 6837Missing in isoform 4. VSP_043156Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
CCDSiCCDS11703.1. [Q96AX2-2]
CCDS32722.1. [Q96AX2-1]
CCDS54161.1. [Q96AX2-3]
CCDS54162.1. [Q96AX2-4]
RefSeqiNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3]
NP_001157462.1. NM_001163990.1. [Q96AX2-4]
NP_783865.1. NM_175738.4. [Q96AX2-2]
UniGeneiHs.351413.

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
GeneIDi326624.
KEGGihsa:326624.
UCSCiuc002jlk.3. human. [Q96AX2-1]
uc010dfu.3. human. [Q96AX2-2]
uc010wrc.2. human. [Q96AX2-3]
uc010wre.2. human. [Q96AX2-4]

Polymorphism databases

DMDMi20139581.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK098068 mRNA. Translation: BAC05227.1 .
AK290202 mRNA. Translation: BAF82891.1 .
AK296172 mRNA. Translation: BAH12272.1 .
AK303442 mRNA. Translation: BAH13962.1 .
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1 .
BC016615 mRNA. Translation: AAH16615.1 .
BC040547 mRNA. Translation: AAH40547.1 .
CCDSi CCDS11703.1. [Q96AX2-2 ]
CCDS32722.1. [Q96AX2-1 ]
CCDS54161.1. [Q96AX2-3 ]
CCDS54162.1. [Q96AX2-4 ]
RefSeqi NP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3 ]
NP_001157462.1. NM_001163990.1. [Q96AX2-4 ]
NP_783865.1. NM_175738.4. [Q96AX2-2 ]
UniGenei Hs.351413.

3D structure databases

ProteinModelPortali Q96AX2.
SMRi Q96AX2. Positions 26-192.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 130604. 4 interactions.
IntActi Q96AX2. 2 interactions.
MINTi MINT-1485128.
STRINGi 9606.ENSP00000376389.

PTM databases

PhosphoSitei Q96AX2.

Polymorphism databases

DMDMi 20139581.

Proteomic databases

MaxQBi Q96AX2.
PaxDbi Q96AX2.
PRIDEi Q96AX2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000392612 ; ENSP00000376388 ; ENSG00000172794 . [Q96AX2-4 ]
ENST00000392613 ; ENSP00000376389 ; ENSG00000172794 . [Q96AX2-1 ]
ENST00000392614 ; ENSP00000376390 ; ENSG00000172794 . [Q96AX2-3 ]
ENST00000402449 ; ENSP00000383934 ; ENSG00000172794 . [Q96AX2-2 ]
ENST00000481224 ; ENSP00000436563 ; ENSG00000172794 . [Q96AX2-1 ]
GeneIDi 326624.
KEGGi hsa:326624.
UCSCi uc002jlk.3. human. [Q96AX2-1 ]
uc010dfu.3. human. [Q96AX2-2 ]
uc010wrc.2. human. [Q96AX2-3 ]
uc010wre.2. human. [Q96AX2-4 ]

Organism-specific databases

CTDi 326624.
GeneCardsi GC17P072666.
HGNCi HGNC:30268. RAB37.
HPAi HPA051858.
MIMi 609956. gene.
neXtProti NX_Q96AX2.
PharmGKBi PA134901093.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
HOGENOMi HOG000233968.
HOVERGENi HBG009351.
KOi K07914.
OMAi HVLHKTI.
PhylomeDBi Q96AX2.
TreeFami TF323428.

Miscellaneous databases

ChiTaRSi RAB37. human.
GeneWikii RAB37.
GenomeRNAii 326624.
NextBioi 96706.
PROi Q96AX2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96AX2.
Bgeei Q96AX2.
CleanExi HS_RAB37.
Genevestigatori Q96AX2.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view ]
Pfami PF00071. Ras. 1 hit.
[Graphical view ]
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00175. RAB. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51419. RAB. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Thalamus, Thymus and Trachea.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Prostate.
  5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 2-11, ACETYLATION AT THR-2.
    Tissue: Platelet.

Entry informationi

Entry nameiRAB37_HUMAN
AccessioniPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: July 9, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi