Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-37

Gene

RAB37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi36 – 438GTPBy similarity
Nucleotide bindingi85 – 895GTPBy similarity
Nucleotide bindingi143 – 1464GTPBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-37
Gene namesi
Name:RAB37
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30268. RAB37.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134901093.

Polymorphism and mutation databases

BioMutaiRAB37.
DMDMi20139581.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 220219Ras-related protein Rab-37PRO_0000121249Add
BLAST
Propeptidei221 – 2233Removed in mature formSequence AnalysisPRO_0000370828

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine1 Publication
Lipidationi219 – 2191S-geranylgeranyl cysteineBy similarity
Modified residuei220 – 2201Cysteine methyl esterSequence Analysis
Lipidationi220 – 2201S-geranylgeranyl cysteineBy similarity

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiQ96AX2.
PaxDbiQ96AX2.
PRIDEiQ96AX2.

PTM databases

PhosphoSiteiQ96AX2.

Expressioni

Gene expression databases

BgeeiQ96AX2.
CleanExiHS_RAB37.
ExpressionAtlasiQ96AX2. baseline and differential.
GenevisibleiQ96AX2. HS.

Organism-specific databases

HPAiHPA051858.

Interactioni

Subunit structurei

Interacts with RIMS1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MAL2Q969L23EBI-748121,EBI-944295

Protein-protein interaction databases

BioGridi130604. 6 interactions.
IntActiQ96AX2. 4 interactions.
MINTiMINT-1485128.
STRINGi9606.ENSP00000376390.

Structurei

3D structure databases

ProteinModelPortaliQ96AX2.
SMRiQ96AX2. Positions 26-192.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi59 – 679Effector regionBy similarity

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00770000120510.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ96AX2.
KOiK07914.
OMAiHVLHKTI.
PhylomeDBiQ96AX2.
TreeFamiTF323428.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK
60 70 80 90 100
DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY
110 120 130 140 150
RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE
160 170 180 190 200
RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD
210 220
EPSFQIRDYV ESQKKRSSCC SFM
Length:223
Mass (Da):24,815
Last modified:January 23, 2007 - v3
Checksum:i5A7A4887BCBB84A8
GO
Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

Show »
Length:216
Mass (Da):24,169
Checksum:i5EBF94A735395D58
GO
Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,663
Checksum:i151A1E30411A53B6
GO
Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.

Note: No experimental confirmation available.
Show »
Length:186
Mass (Da):20,894
Checksum:i728BB40C23162B5F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti188 – 1881A → P.
Corresponds to variant rs34215331 [ dbSNP | Ensembl ].
VAR_034434

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. 2 PublicationsVSP_041268Add
BLAST
Alternative sequencei1 – 3030MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. 1 PublicationVSP_043155Add
BLAST
Alternative sequencei32 – 6837Missing in isoform 4. 1 PublicationVSP_043156Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
CCDSiCCDS11703.1. [Q96AX2-2]
CCDS32722.1. [Q96AX2-1]
CCDS54161.1. [Q96AX2-3]
CCDS54162.1. [Q96AX2-4]
RefSeqiNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3]
NP_001157462.1. NM_001163990.1. [Q96AX2-4]
NP_783865.1. NM_175738.4. [Q96AX2-2]
UniGeneiHs.351413.

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794. [Q96AX2-1]
GeneIDi326624.
KEGGihsa:326624.
UCSCiuc002jlk.3. human. [Q96AX2-1]
uc010dfu.3. human. [Q96AX2-2]
uc010wrc.2. human. [Q96AX2-3]
uc010wre.2. human. [Q96AX2-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
CCDSiCCDS11703.1. [Q96AX2-2]
CCDS32722.1. [Q96AX2-1]
CCDS54161.1. [Q96AX2-3]
CCDS54162.1. [Q96AX2-4]
RefSeqiNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3]
NP_001157462.1. NM_001163990.1. [Q96AX2-4]
NP_783865.1. NM_175738.4. [Q96AX2-2]
UniGeneiHs.351413.

3D structure databases

ProteinModelPortaliQ96AX2.
SMRiQ96AX2. Positions 26-192.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130604. 6 interactions.
IntActiQ96AX2. 4 interactions.
MINTiMINT-1485128.
STRINGi9606.ENSP00000376390.

PTM databases

PhosphoSiteiQ96AX2.

Polymorphism and mutation databases

BioMutaiRAB37.
DMDMi20139581.

Proteomic databases

MaxQBiQ96AX2.
PaxDbiQ96AX2.
PRIDEiQ96AX2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794. [Q96AX2-1]
GeneIDi326624.
KEGGihsa:326624.
UCSCiuc002jlk.3. human. [Q96AX2-1]
uc010dfu.3. human. [Q96AX2-2]
uc010wrc.2. human. [Q96AX2-3]
uc010wre.2. human. [Q96AX2-4]

Organism-specific databases

CTDi326624.
GeneCardsiGC17P072666.
HGNCiHGNC:30268. RAB37.
HPAiHPA051858.
MIMi609956. gene.
neXtProtiNX_Q96AX2.
PharmGKBiPA134901093.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00770000120510.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ96AX2.
KOiK07914.
OMAiHVLHKTI.
PhylomeDBiQ96AX2.
TreeFamiTF323428.

Miscellaneous databases

ChiTaRSiRAB37. human.
GeneWikiiRAB37.
GenomeRNAii326624.
NextBioi96706.
PROiQ96AX2.
SOURCEiSearch...

Gene expression databases

BgeeiQ96AX2.
CleanExiHS_RAB37.
ExpressionAtlasiQ96AX2. baseline and differential.
GenevisibleiQ96AX2. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Thalamus, Thymus and Trachea.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Prostate.
  5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 2-11, ACETYLATION AT THR-2.
    Tissue: Platelet.

Entry informationi

Entry nameiRAB37_HUMAN
AccessioniPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: June 24, 2015
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.