Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-37

Gene

RAB37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi36 – 43GTPBy similarity8
Nucleotide bindingi85 – 89GTPBy similarity5
Nucleotide bindingi143 – 146GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000172794-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-37
Gene namesi
Name:RAB37
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30268. RAB37.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Organism-specific databases

DisGeNETi326624.
OpenTargetsiENSG00000172794.
PharmGKBiPA134901093.

Polymorphism and mutation databases

BioMutaiRAB37.
DMDMi20139581.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001212492 – 220Ras-related protein Rab-37Add BLAST219
PropeptideiPRO_0000370828221 – 223Removed in mature formSequence analysis3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonine1 Publication1
Lipidationi219S-geranylgeranyl cysteineBy similarity1
Modified residuei220Cysteine methyl esterSequence analysis1
Lipidationi220S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiQ96AX2.
PaxDbiQ96AX2.
PeptideAtlasiQ96AX2.
PRIDEiQ96AX2.

PTM databases

iPTMnetiQ96AX2.
PhosphoSitePlusiQ96AX2.

Expressioni

Gene expression databases

BgeeiENSG00000172794.
CleanExiHS_RAB37.
ExpressionAtlasiQ96AX2. baseline and differential.
GenevisibleiQ96AX2. HS.

Organism-specific databases

HPAiHPA051858.

Interactioni

Subunit structurei

Interacts with RIMS1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MAL2Q969L23EBI-748121,EBI-944295

Protein-protein interaction databases

BioGridi130604. 5 interactors.
IntActiQ96AX2. 4 interactors.
MINTiMINT-1485128.
STRINGi9606.ENSP00000376390.

Structurei

3D structure databases

ProteinModelPortaliQ96AX2.
SMRiQ96AX2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi59 – 67Effector regionBy similarity9

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiKOG0083. Eukaryota.
ENOG410Z9H6. LUCA.
GeneTreeiENSGT00860000133675.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ96AX2.
KOiK07914.
OMAiHVLHKTI.
OrthoDBiEOG091G0JXU.
PhylomeDBiQ96AX2.
TreeFamiTF323428.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK
60 70 80 90 100
DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY
110 120 130 140 150
RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE
160 170 180 190 200
RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD
210 220
EPSFQIRDYV ESQKKRSSCC SFM
Length:223
Mass (Da):24,815
Last modified:January 23, 2007 - v3
Checksum:i5A7A4887BCBB84A8
GO
Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

Show »
Length:216
Mass (Da):24,169
Checksum:i5EBF94A735395D58
GO
Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,663
Checksum:i151A1E30411A53B6
GO
Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.

Note: No experimental confirmation available.
Show »
Length:186
Mass (Da):20,894
Checksum:i728BB40C23162B5F
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034434188A → P.Corresponds to variant rs34215331dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0412681 – 68MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_0431551 – 30MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_04315632 – 68Missing in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
CCDSiCCDS11703.1. [Q96AX2-2]
CCDS32722.1. [Q96AX2-1]
CCDS54161.1. [Q96AX2-3]
CCDS54162.1. [Q96AX2-4]
RefSeqiNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3]
NP_001157462.1. NM_001163990.1. [Q96AX2-4]
NP_001317400.1. NM_001330471.1.
NP_783865.1. NM_175738.4. [Q96AX2-2]
UniGeneiHs.351413.

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794. [Q96AX2-1]
GeneIDi326624.
KEGGihsa:326624.
UCSCiuc002jlk.4. human. [Q96AX2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA. Translation: BAC05227.1.
AK290202 mRNA. Translation: BAF82891.1.
AK296172 mRNA. Translation: BAH12272.1.
AK303442 mRNA. Translation: BAH13962.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89180.1.
BC016615 mRNA. Translation: AAH16615.1.
BC040547 mRNA. Translation: AAH40547.1.
CCDSiCCDS11703.1. [Q96AX2-2]
CCDS32722.1. [Q96AX2-1]
CCDS54161.1. [Q96AX2-3]
CCDS54162.1. [Q96AX2-4]
RefSeqiNP_001006639.1. NM_001006638.2.
NP_001157461.1. NM_001163989.1. [Q96AX2-3]
NP_001157462.1. NM_001163990.1. [Q96AX2-4]
NP_001317400.1. NM_001330471.1.
NP_783865.1. NM_175738.4. [Q96AX2-2]
UniGeneiHs.351413.

3D structure databases

ProteinModelPortaliQ96AX2.
SMRiQ96AX2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130604. 5 interactors.
IntActiQ96AX2. 4 interactors.
MINTiMINT-1485128.
STRINGi9606.ENSP00000376390.

PTM databases

iPTMnetiQ96AX2.
PhosphoSitePlusiQ96AX2.

Polymorphism and mutation databases

BioMutaiRAB37.
DMDMi20139581.

Proteomic databases

MaxQBiQ96AX2.
PaxDbiQ96AX2.
PeptideAtlasiQ96AX2.
PRIDEiQ96AX2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794. [Q96AX2-1]
GeneIDi326624.
KEGGihsa:326624.
UCSCiuc002jlk.4. human. [Q96AX2-1]

Organism-specific databases

CTDi326624.
DisGeNETi326624.
GeneCardsiRAB37.
HGNCiHGNC:30268. RAB37.
HPAiHPA051858.
MIMi609956. gene.
neXtProtiNX_Q96AX2.
OpenTargetsiENSG00000172794.
PharmGKBiPA134901093.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0083. Eukaryota.
ENOG410Z9H6. LUCA.
GeneTreeiENSGT00860000133675.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ96AX2.
KOiK07914.
OMAiHVLHKTI.
OrthoDBiEOG091G0JXU.
PhylomeDBiQ96AX2.
TreeFamiTF323428.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000172794-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Miscellaneous databases

ChiTaRSiRAB37. human.
GeneWikiiRAB37.
GenomeRNAii326624.
PROiQ96AX2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172794.
CleanExiHS_RAB37.
ExpressionAtlasiQ96AX2. baseline and differential.
GenevisibleiQ96AX2. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRAB37_HUMAN
AccessioniPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.