Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96AX2

- RAB37_HUMAN

UniProt

Q96AX2 - RAB37_HUMAN

Protein

Ras-related protein Rab-37

Gene

RAB37

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi36 – 438GTPBy similarity
    Nucleotide bindingi85 – 895GTPBy similarity
    Nucleotide bindingi143 – 1464GTPBy similarity

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW

    GO - Biological processi

    1. protein transport Source: UniProtKB-KW
    2. small GTPase mediated signal transduction Source: InterPro

    Keywords - Biological processi

    Protein transport, Transport

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-related protein Rab-37
    Gene namesi
    Name:RAB37
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:30268. RAB37.

    Subcellular locationi

    Cytoplasmic vesicle
    Note: Secretory granules.By similarity

    GO - Cellular componenti

    1. endoplasmic reticulum-Golgi intermediate compartment Source: UniProtKB
    2. secretory granule Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasmic vesicle

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134901093.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 220219Ras-related protein Rab-37PRO_0000121249Add
    BLAST
    Propeptidei221 – 2233Removed in mature formSequence AnalysisPRO_0000370828

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylthreonine1 Publication
    Lipidationi219 – 2191S-geranylgeranyl cysteineBy similarity
    Modified residuei220 – 2201Cysteine methyl esterSequence Analysis
    Lipidationi220 – 2201S-geranylgeranyl cysteineBy similarity

    Keywords - PTMi

    Acetylation, Lipoprotein, Methylation, Prenylation

    Proteomic databases

    MaxQBiQ96AX2.
    PaxDbiQ96AX2.
    PRIDEiQ96AX2.

    PTM databases

    PhosphoSiteiQ96AX2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96AX2.
    BgeeiQ96AX2.
    CleanExiHS_RAB37.
    GenevestigatoriQ96AX2.

    Organism-specific databases

    HPAiHPA051858.

    Interactioni

    Subunit structurei

    Interacts with RIMS1.By similarity

    Protein-protein interaction databases

    BioGridi130604. 4 interactions.
    IntActiQ96AX2. 2 interactions.
    MINTiMINT-1485128.
    STRINGi9606.ENSP00000376389.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96AX2.
    SMRiQ96AX2. Positions 26-192.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi59 – 679Effector regionBy similarity

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Rab family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000233968.
    HOVERGENiHBG009351.
    KOiK07914.
    OMAiHVLHKTI.
    PhylomeDBiQ96AX2.
    TreeFamiTF323428.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view]
    PfamiPF00071. Ras. 1 hit.
    [Graphical view]
    PRINTSiPR00449. RASTRNSFRMNG.
    SMARTiSM00175. RAB. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51419. RAB. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK    50
    DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY 100
    RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE 150
    RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD 200
    EPSFQIRDYV ESQKKRSSCC SFM 223
    Length:223
    Mass (Da):24,815
    Last modified:January 23, 2007 - v3
    Checksum:i5A7A4887BCBB84A8
    GO
    Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

    Show »
    Length:216
    Mass (Da):24,169
    Checksum:i5EBF94A735395D58
    GO
    Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

    Note: No experimental confirmation available.

    Show »
    Length:228
    Mass (Da):25,663
    Checksum:i151A1E30411A53B6
    GO
    Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         32-68: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:186
    Mass (Da):20,894
    Checksum:i728BB40C23162B5F
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti188 – 1881A → P.
    Corresponds to variant rs34215331 [ dbSNP | Ensembl ].
    VAR_034434

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6868MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. 2 PublicationsVSP_041268Add
    BLAST
    Alternative sequencei1 – 3030MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. 1 PublicationVSP_043155Add
    BLAST
    Alternative sequencei32 – 6837Missing in isoform 4. 1 PublicationVSP_043156Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK098068 mRNA. Translation: BAC05227.1.
    AK290202 mRNA. Translation: BAF82891.1.
    AK296172 mRNA. Translation: BAH12272.1.
    AK303442 mRNA. Translation: BAH13962.1.
    AC016888 Genomic DNA. No translation available.
    AC064805 Genomic DNA. No translation available.
    CH471099 Genomic DNA. Translation: EAW89180.1.
    BC016615 mRNA. Translation: AAH16615.1.
    BC040547 mRNA. Translation: AAH40547.1.
    CCDSiCCDS11703.1. [Q96AX2-2]
    CCDS32722.1. [Q96AX2-1]
    CCDS54161.1. [Q96AX2-3]
    CCDS54162.1. [Q96AX2-4]
    RefSeqiNP_001006639.1. NM_001006638.2.
    NP_001157461.1. NM_001163989.1. [Q96AX2-3]
    NP_001157462.1. NM_001163990.1. [Q96AX2-4]
    NP_783865.1. NM_175738.4. [Q96AX2-2]
    UniGeneiHs.351413.

    Genome annotation databases

    EnsembliENST00000392612; ENSP00000376388; ENSG00000172794. [Q96AX2-4]
    ENST00000392613; ENSP00000376389; ENSG00000172794. [Q96AX2-1]
    ENST00000392614; ENSP00000376390; ENSG00000172794. [Q96AX2-3]
    ENST00000402449; ENSP00000383934; ENSG00000172794. [Q96AX2-2]
    ENST00000481224; ENSP00000436563; ENSG00000172794. [Q96AX2-1]
    GeneIDi326624.
    KEGGihsa:326624.
    UCSCiuc002jlk.3. human. [Q96AX2-1]
    uc010dfu.3. human. [Q96AX2-2]
    uc010wrc.2. human. [Q96AX2-3]
    uc010wre.2. human. [Q96AX2-4]

    Polymorphism databases

    DMDMi20139581.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK098068 mRNA. Translation: BAC05227.1 .
    AK290202 mRNA. Translation: BAF82891.1 .
    AK296172 mRNA. Translation: BAH12272.1 .
    AK303442 mRNA. Translation: BAH13962.1 .
    AC016888 Genomic DNA. No translation available.
    AC064805 Genomic DNA. No translation available.
    CH471099 Genomic DNA. Translation: EAW89180.1 .
    BC016615 mRNA. Translation: AAH16615.1 .
    BC040547 mRNA. Translation: AAH40547.1 .
    CCDSi CCDS11703.1. [Q96AX2-2 ]
    CCDS32722.1. [Q96AX2-1 ]
    CCDS54161.1. [Q96AX2-3 ]
    CCDS54162.1. [Q96AX2-4 ]
    RefSeqi NP_001006639.1. NM_001006638.2.
    NP_001157461.1. NM_001163989.1. [Q96AX2-3 ]
    NP_001157462.1. NM_001163990.1. [Q96AX2-4 ]
    NP_783865.1. NM_175738.4. [Q96AX2-2 ]
    UniGenei Hs.351413.

    3D structure databases

    ProteinModelPortali Q96AX2.
    SMRi Q96AX2. Positions 26-192.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 130604. 4 interactions.
    IntActi Q96AX2. 2 interactions.
    MINTi MINT-1485128.
    STRINGi 9606.ENSP00000376389.

    PTM databases

    PhosphoSitei Q96AX2.

    Polymorphism databases

    DMDMi 20139581.

    Proteomic databases

    MaxQBi Q96AX2.
    PaxDbi Q96AX2.
    PRIDEi Q96AX2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000392612 ; ENSP00000376388 ; ENSG00000172794 . [Q96AX2-4 ]
    ENST00000392613 ; ENSP00000376389 ; ENSG00000172794 . [Q96AX2-1 ]
    ENST00000392614 ; ENSP00000376390 ; ENSG00000172794 . [Q96AX2-3 ]
    ENST00000402449 ; ENSP00000383934 ; ENSG00000172794 . [Q96AX2-2 ]
    ENST00000481224 ; ENSP00000436563 ; ENSG00000172794 . [Q96AX2-1 ]
    GeneIDi 326624.
    KEGGi hsa:326624.
    UCSCi uc002jlk.3. human. [Q96AX2-1 ]
    uc010dfu.3. human. [Q96AX2-2 ]
    uc010wrc.2. human. [Q96AX2-3 ]
    uc010wre.2. human. [Q96AX2-4 ]

    Organism-specific databases

    CTDi 326624.
    GeneCardsi GC17P072666.
    HGNCi HGNC:30268. RAB37.
    HPAi HPA051858.
    MIMi 609956. gene.
    neXtProti NX_Q96AX2.
    PharmGKBi PA134901093.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000233968.
    HOVERGENi HBG009351.
    KOi K07914.
    OMAi HVLHKTI.
    PhylomeDBi Q96AX2.
    TreeFami TF323428.

    Miscellaneous databases

    ChiTaRSi RAB37. human.
    GeneWikii RAB37.
    GenomeRNAii 326624.
    NextBioi 96706.
    PROi Q96AX2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96AX2.
    Bgeei Q96AX2.
    CleanExi HS_RAB37.
    Genevestigatori Q96AX2.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view ]
    Pfami PF00071. Ras. 1 hit.
    [Graphical view ]
    PRINTSi PR00449. RASTRNSFRMNG.
    SMARTi SM00175. RAB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51419. RAB. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Tissue: Thalamus, Thymus and Trachea.
    2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Prostate.
    5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
      Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
      Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 2-11, ACETYLATION AT THR-2.
      Tissue: Platelet.

    Entry informationi

    Entry nameiRAB37_HUMAN
    AccessioniPrimary (citable) accession number: Q96AX2
    Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 31, 2002
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 122 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3