Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endothelial cell-selective adhesion molecule

Gene

ESAM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Can mediate aggregation most likely through a homophilic molecular interaction.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000149564-MONOMER.
ReactomeiR-HSA-202733. Cell surface interactions at the vascular wall.

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelial cell-selective adhesion molecule
Gene namesi
Name:ESAM
ORF Names:UNQ220/PRO246
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:17474. ESAM.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 248ExtracellularSequence analysisAdd BLAST219
Transmembranei249 – 269HelicalSequence analysisAdd BLAST21
Topological domaini270 – 390CytoplasmicSequence analysisAdd BLAST121

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Tight junction

Pathology & Biotechi

Organism-specific databases

DisGeNETi90952.
OpenTargetsiENSG00000149564.
PharmGKBiPA134954912.

Polymorphism and mutation databases

BioMutaiESAM.
DMDMi68052240.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 291 PublicationAdd BLAST29
ChainiPRO_000001475230 – 390Endothelial cell-selective adhesion moleculeAdd BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi108N-linked (GlcNAc...)Sequence analysis1
Glycosylationi169N-linked (GlcNAc...)1 Publication1
Disulfide bondi174 ↔ 224PROSITE-ProRule annotation
Glycosylationi213N-linked (GlcNAc...)Sequence analysis1
Glycosylationi236N-linked (GlcNAc...)Sequence analysis1
Modified residuei301PhosphoserineBy similarity1
Modified residuei332PhosphothreonineBy similarity1
Modified residuei334PhosphothreonineBy similarity1
Modified residuei336PhosphoserineBy similarity1
Modified residuei339PhosphoserineBy similarity1
Modified residuei344PhosphoserineBy similarity1
Modified residuei371PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96AP7.
PaxDbiQ96AP7.
PeptideAtlasiQ96AP7.
PRIDEiQ96AP7.

PTM databases

iPTMnetiQ96AP7.
PhosphoSitePlusiQ96AP7.

Expressioni

Tissue specificityi

Highly expressed in endothelial cells.1 Publication

Gene expression databases

BgeeiENSG00000149564.
CleanExiHS_ESAM.
ExpressionAtlasiQ96AP7. baseline and differential.
GenevisibleiQ96AP7. HS.

Organism-specific databases

HPAiHPA051043.
HPA056293.

Interactioni

Subunit structurei

Interacts with BAIAP1.By similarity

Protein-protein interaction databases

BioGridi124781. 5 interactors.
STRINGi9606.ENSP00000278927.

Structurei

3D structure databases

ProteinModelPortaliQ96AP7.
SMRiQ96AP7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 143Ig-like V-typeAdd BLAST114
Domaini153 – 242Ig-like C2-typeAdd BLAST90

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHVB. Eukaryota.
ENOG4111DT8. LUCA.
GeneTreeiENSGT00760000119145.
HOGENOMiHOG000111222.
HOVERGENiHBG000420.
InParanoidiQ96AP7.
KOiK06787.
OMAiYSMPSRN.
OrthoDBiEOG091G05PI.
PhylomeDBiQ96AP7.
TreeFamiTF330875.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AP7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISLPGPLVT NLLRFLFLGL SALAPPSRAQ LQLHLPANRL QAVEGGEVVL
60 70 80 90 100
PAWYTLHGEV SSSQPWEVPF VMWFFKQKEK EDQVLSYING VTTSKPGVSL
110 120 130 140 150
VYSMPSRNLS LRLEGLQEKD SGPYSCSVNV QDKQGKSRGH SIKTLELNVL
160 170 180 190 200
VPPAPPSCRL QGVPHVGANV TLSCQSPRSK PAVQYQWDRQ LPSFQTFFAP
210 220 230 240 250
ALDVIRGSLS LTNLSSSMAG VYVCKAHNEV GTAQCNVTLE VSTGPGAAVV
260 270 280 290 300
AGAVVGTLVG LGLLAGLVLL YHRRGKALEE PANDIKEDAI APRTLPWPKS
310 320 330 340 350
SDTISKNGTL SSVTSARALR PPHGPPRPGA LTPTPSLSSQ ALPSPRLPTT
360 370 380 390
DGAHPQPISP IPGGVSSSGL SRMGAVPVMV PAQSQAGSLV
Length:390
Mass (Da):41,176
Last modified:December 1, 2001 - v1
Checksum:iC5E3F302F41B6EEC
GO
Isoform 2 (identifier: Q96AP7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     22-200: Missing.
     287-320: EDAIAPRTLPWPKSSDTISKNGTLSSVTSARALR → VRSPLGLSFSAPKMEWLWKWRDAHFYRDSYLSKW
     321-390: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,170
Checksum:iEDC1A98341007458
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti380V → M in AAK51065 (PubMed:11279107).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049872273R → C.Corresponds to variant rs12792040dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05559422 – 200Missing in isoform 2. 1 PublicationAdd BLAST179
Alternative sequenceiVSP_055595287 – 320EDAIA…ARALR → VRSPLGLSFSAPKMEWLWKW RDAHFYRDSYLSKW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_055596321 – 390Missing in isoform 2. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361746 mRNA. Translation: AAK51065.1.
AY358382 mRNA. Translation: AAQ88748.1.
AK075396 mRNA. Translation: BAC11594.1.
AK301160 mRNA. Translation: BAG62750.1.
AP000866 Genomic DNA. No translation available.
BC016868 mRNA. Translation: AAH16868.1.
CCDSiCCDS8453.1. [Q96AP7-1]
RefSeqiNP_620411.2. NM_138961.2. [Q96AP7-1]
UniGeneiHs.173840.

Genome annotation databases

EnsembliENST00000278927; ENSP00000278927; ENSG00000149564. [Q96AP7-1]
ENST00000444566; ENSP00000406689; ENSG00000149564. [Q96AP7-2]
GeneIDi90952.
KEGGihsa:90952.
UCSCiuc001qav.5. human. [Q96AP7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361746 mRNA. Translation: AAK51065.1.
AY358382 mRNA. Translation: AAQ88748.1.
AK075396 mRNA. Translation: BAC11594.1.
AK301160 mRNA. Translation: BAG62750.1.
AP000866 Genomic DNA. No translation available.
BC016868 mRNA. Translation: AAH16868.1.
CCDSiCCDS8453.1. [Q96AP7-1]
RefSeqiNP_620411.2. NM_138961.2. [Q96AP7-1]
UniGeneiHs.173840.

3D structure databases

ProteinModelPortaliQ96AP7.
SMRiQ96AP7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124781. 5 interactors.
STRINGi9606.ENSP00000278927.

PTM databases

iPTMnetiQ96AP7.
PhosphoSitePlusiQ96AP7.

Polymorphism and mutation databases

BioMutaiESAM.
DMDMi68052240.

Proteomic databases

MaxQBiQ96AP7.
PaxDbiQ96AP7.
PeptideAtlasiQ96AP7.
PRIDEiQ96AP7.

Protocols and materials databases

DNASUi90952.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278927; ENSP00000278927; ENSG00000149564. [Q96AP7-1]
ENST00000444566; ENSP00000406689; ENSG00000149564. [Q96AP7-2]
GeneIDi90952.
KEGGihsa:90952.
UCSCiuc001qav.5. human. [Q96AP7-1]

Organism-specific databases

CTDi90952.
DisGeNETi90952.
GeneCardsiESAM.
H-InvDBHIX0201692.
HGNCiHGNC:17474. ESAM.
HPAiHPA051043.
HPA056293.
MIMi614281. gene.
neXtProtiNX_Q96AP7.
OpenTargetsiENSG00000149564.
PharmGKBiPA134954912.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHVB. Eukaryota.
ENOG4111DT8. LUCA.
GeneTreeiENSGT00760000119145.
HOGENOMiHOG000111222.
HOVERGENiHBG000420.
InParanoidiQ96AP7.
KOiK06787.
OMAiYSMPSRN.
OrthoDBiEOG091G05PI.
PhylomeDBiQ96AP7.
TreeFamiTF330875.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000149564-MONOMER.
ReactomeiR-HSA-202733. Cell surface interactions at the vascular wall.

Miscellaneous databases

GeneWikiiESAM_(gene).
GenomeRNAii90952.
PROiQ96AP7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000149564.
CleanExiHS_ESAM.
ExpressionAtlasiQ96AP7. baseline and differential.
GenevisibleiQ96AP7. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiESAM_HUMAN
AccessioniPrimary (citable) accession number: Q96AP7
Secondary accession number(s): B4DVN8, Q96T50
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.