Q96AH0 (SOSB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SOSS complex subunit B2 Alternative name(s): Nucleic acid-binding protein 1 Oligonucleotide/oligosaccharide-binding fold-containing protein 2A Sensor of single-strand DNA complex subunit B2 Sensor of ssDNA subunit B2 Short name=SOSS-B2 Single-stranded DNA-binding protein 2 Short name=hSSB2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 204 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. Ref.6 Ref.7 |
| Subunit structure | Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1. Ref.6 Ref.7 |
| Subcellular location | Nucleus. Note: Localizes to nuclear foci following DNA damage. Ref.6 Ref.7 |
| Sequence similarities | Belongs to the SOSS-B family. SOSS-B2 subfamily. Contains 1 OB DNA-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle checkpoint Inferred from mutant phenotype Ref.7. Source: UniProtKB double-strand break repair via homologous recombinationInferred from mutant phenotype Ref.6. Source: UniProtKB response to ionizing radiationInferred from mutant phenotype Ref.6Ref.7. Source: UniProtKB |
| Cellular_component | SOSS complex Inferred from direct assay PubMed 18449195Ref.7. Source: UniProtKB |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: Compara single-stranded DNA bindingInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96AH0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96AH0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-80: Missing. | ||||||
| Isoform 3 (identifier: Q96AH0-3) The sequence of this isoform differs from the canonical sequence as follows: 101-134: EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN → DLGAVQAAAMRDSIHYYPGNDLHPDLEEPSSLGV 135-204: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 204 | 204 | SOSS complex subunit B2 | PRO_0000333954 | |||||
Regions | |||||||||
| DNA binding | 26 – 99 | 74 | OB | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 80 | 80 | Missing in isoform 2. | VSP_033600 | |||||
| Alternative sequence | 101 – 134 | 34 | EFCMV…EQKNN → DLGAVQAAAMRDSIHYYPGN DLHPDLEEPSSLGV in isoform 3. | VSP_033601 | |||||
| Alternative sequence | 135 – 204 | 70 | Missing in isoform 3. | VSP_033602 | |||||
| Natural variant | 154 | 1 | T → S. Corresponds to variant rs12612256 [ dbSNP | Ensembl ]. | VAR_043340 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Ileal mucosa. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Bone marrow. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Uterus. |
| [6] | "hSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response." Li Y., Bolderson E., Kumar R., Muniandy P.A., Xue Y., Richard D.J., Seidman M., Pandita T.K., Khanna K.K., Wang W. J. Biol. Chem. 284:23525-23531(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX. |
| [7] | "SOSS complexes participate in the maintenance of genomic stability." Huang J., Gong Z., Ghosal G., Chen J. Mol. Cell 35:384-393(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN THE SOSS COMPLEX, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK026486 mRNA. Translation: BAB15491.1. AL832659 mRNA. Translation: CAH56209.1. AC114778 Genomic DNA. Translation: AAY24348.1. CH471058 Genomic DNA. Translation: EAX10836.1. CH471058 Genomic DNA. Translation: EAX10837.1. CH471058 Genomic DNA. Translation: EAX10838.1. BC017114 mRNA. Translation: AAH17114.1. BC107723 mRNA. Translation: AAI07724.1. |
| IPI | IPI00010228. IPI00059434. IPI00892743. |
| RefSeq | NP_001026886.1. NM_001031716.2. NP_001241665.1. NM_001254736.1. |
| UniGene | Hs.591610. |
3D structure databases | |
| ProteinModelPortal | Q96AH0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000403683. |
Polymorphism databases | |
| DMDM | 74760705. |
Proteomic databases | |
| PaxDb | Q96AH0. |
| PRIDE | Q96AH0. |
Protocols and materials databases | |
| DNASU | 64859. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000307849; ENSP00000307968; ENSG00000173559. ENST00000409510; ENSP00000386605; ENSG00000173559. ENST00000410026; ENSP00000387243; ENSG00000173559. ENST00000425611; ENSP00000403683; ENSG00000173559. ENST00000451500; ENSP00000390901; ENSG00000173559. |
| GeneID | 64859. |
| KEGG | hsa:64859. |
| UCSC | uc002usw.3. human. uc021vug.1. human. |
Organism-specific databases | |
| CTD | 64859. |
| GeneCards | GC02P192543. |
| H-InvDB | HIX0002686. |
| HGNC | HGNC:26232. NABP1. |
| MIM | 612103. gene. |
| neXtProt | NX_Q96AH0. |
| PharmGKB | PA143485566. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG285523. |
| HOGENOM | HOG000006622. |
| InParanoid | Q96AH0. |
| OMA | VHTGPES. |
| PhylomeDB | Q96AH0. |
Gene expression databases | |
| ArrayExpress | Q96AH0. |
| Bgee | Q96AH0. |
| CleanEx | HS_OBFC2A. |
| Genevestigator | Q96AH0. |
Family and domain databases | |
| Gene3D | 2.40.50.140. 1 hit. |
| InterPro | IPR012340. NA-bd_OB-fold. IPR004365. NA-bd_OB_tRNA-helicase. [Graphical view] |
| Pfam | PF01336. tRNA_anti. 1 hit. [Graphical view] |
| SUPFAM | SSF50249. Nucleic_acid_OB. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 64859. |
| NextBio | 67011. |
| SOURCE | Search... |
Entry information
| Entry name | SOSB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96AH0 Secondary accession number(s): Q658Y8, Q9H5X6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
