Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96AH0

- SOSB2_HUMAN

UniProt

Q96AH0 - SOSB2_HUMAN

Protein

SOSS complex subunit B2

Gene

NABP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.2 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi26 – 9974OBAdd
    BLAST

    GO - Molecular functioni

    1. RNA binding Source: Ensembl
    2. single-stranded DNA binding Source: UniProtKB

    GO - Biological processi

    1. cellular response to DNA damage stimulus Source: UniProtKB
    2. DNA repair Source: UniProtKB
    3. double-strand break repair via homologous recombination Source: UniProtKB
    4. mitotic cell cycle checkpoint Source: UniProtKB
    5. response to ionizing radiation Source: UniProtKB

    Keywords - Biological processi

    DNA damage, DNA repair

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SOSS complex subunit B2
    Alternative name(s):
    Nucleic acid-binding protein 1
    Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
    Sensor of single-strand DNA complex subunit B2
    Sensor of ssDNA subunit B2
    Short name:
    SOSS-B2
    Single-stranded DNA-binding protein 2
    Short name:
    hSSB2
    Gene namesi
    Name:NABP1
    Synonyms:OBFC2A, SSB2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:26232. NABP1.

    Subcellular locationi

    Nucleus 2 Publications
    Note: Localizes to nuclear foci following DNA damage.

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleus Source: UniProtKB
    3. SOSS complex Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti520. Acute promyelocytic leukemia.
    PharmGKBiPA143485566.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 204204SOSS complex subunit B2PRO_0000333954Add
    BLAST

    Proteomic databases

    MaxQBiQ96AH0.
    PaxDbiQ96AH0.
    PRIDEiQ96AH0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96AH0.
    BgeeiQ96AH0.
    CleanExiHS_OBFC2A.
    GenevestigatoriQ96AH0.

    Organism-specific databases

    HPAiHPA054978.

    Interactioni

    Subunit structurei

    Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1.2 Publications

    Protein-protein interaction databases

    BioGridi122332. 5 interactions.
    STRINGi9606.ENSP00000403683.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96AH0.
    SMRiQ96AH0. Positions 9-101.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the SOSS-B family. SOSS-B2 subfamily.Curated
    Contains 1 OB DNA-binding domain.Curated

    Phylogenomic databases

    eggNOGiNOG285523.
    HOGENOMiHOG000006622.
    InParanoidiQ96AH0.
    OMAiSASARFY.
    PhylomeDBiQ96AH0.
    TreeFamiTF313902.

    Family and domain databases

    Gene3Di2.40.50.140. 1 hit.
    InterProiIPR012340. NA-bd_OB-fold.
    IPR004365. NA-bd_OB_tRNA.
    [Graphical view]
    PfamiPF01336. tRNA_anti-codon. 1 hit.
    [Graphical view]
    SUPFAMiSSF50249. SSF50249. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96AH0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNRVNDPLIF IRDIKPGLKN LNVVFIVLEI GRVTKTKDGH EVRSCKVADK    50
    TGSITISVWD EIGGLIQPGD IIRLTRGYAS MWKGCLTLYT GRGGELQKIG 100
    EFCMVYSEVP NFSEPNPDYR GQQNKGAQSE QKNNSMNSNM GTGTFGPVGN 150
    GVHTGPESRE HQFSHAGRSN GRGLINPQLQ GTASNQTVMT TISNGRDPRR 200
    AFKR 204
    Length:204
    Mass (Da):22,423
    Last modified:December 1, 2001 - v1
    Checksum:iEF7579A452381E47
    GO
    Isoform 2 (identifier: Q96AH0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-80: Missing.

    Show »
    Length:124
    Mass (Da):13,579
    Checksum:i285E087256426CAC
    GO
    Isoform 3 (identifier: Q96AH0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         101-134: EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN → DLGAVQAAAMRDSIHYYPGNDLHPDLEEPSSLGV
         135-204: Missing.

    Show »
    Length:134
    Mass (Da):14,677
    Checksum:i9243CCF90A5E06E2
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti154 – 1541T → S.
    Corresponds to variant rs12612256 [ dbSNP | Ensembl ].
    VAR_043340

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8080Missing in isoform 2. 2 PublicationsVSP_033600Add
    BLAST
    Alternative sequencei101 – 13434EFCMV…EQKNN → DLGAVQAAAMRDSIHYYPGN DLHPDLEEPSSLGV in isoform 3. 1 PublicationVSP_033601Add
    BLAST
    Alternative sequencei135 – 20470Missing in isoform 3. 1 PublicationVSP_033602Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026486 mRNA. Translation: BAB15491.1.
    AL832659 mRNA. Translation: CAH56209.1.
    AC114778 Genomic DNA. Translation: AAY24348.1.
    CH471058 Genomic DNA. Translation: EAX10836.1.
    CH471058 Genomic DNA. Translation: EAX10837.1.
    CH471058 Genomic DNA. Translation: EAX10838.1.
    BC017114 mRNA. Translation: AAH17114.1.
    BC107723 mRNA. Translation: AAI07724.1.
    CCDSiCCDS33352.1. [Q96AH0-1]
    CCDS58745.1. [Q96AH0-2]
    RefSeqiNP_001026886.1. NM_001031716.2. [Q96AH0-1]
    NP_001241665.1. NM_001254736.1. [Q96AH0-2]
    UniGeneiHs.591610.

    Genome annotation databases

    EnsembliENST00000307849; ENSP00000307968; ENSG00000173559. [Q96AH0-3]
    ENST00000409510; ENSP00000386605; ENSG00000173559. [Q96AH0-2]
    ENST00000410026; ENSP00000387243; ENSG00000173559. [Q96AH0-2]
    ENST00000425611; ENSP00000403683; ENSG00000173559. [Q96AH0-1]
    ENST00000451500; ENSP00000390901; ENSG00000173559. [Q96AH0-3]
    GeneIDi64859.
    KEGGihsa:64859.
    UCSCiuc002usw.3. human. [Q96AH0-1]
    uc021vug.1. human. [Q96AH0-2]

    Polymorphism databases

    DMDMi74760705.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026486 mRNA. Translation: BAB15491.1 .
    AL832659 mRNA. Translation: CAH56209.1 .
    AC114778 Genomic DNA. Translation: AAY24348.1 .
    CH471058 Genomic DNA. Translation: EAX10836.1 .
    CH471058 Genomic DNA. Translation: EAX10837.1 .
    CH471058 Genomic DNA. Translation: EAX10838.1 .
    BC017114 mRNA. Translation: AAH17114.1 .
    BC107723 mRNA. Translation: AAI07724.1 .
    CCDSi CCDS33352.1. [Q96AH0-1 ]
    CCDS58745.1. [Q96AH0-2 ]
    RefSeqi NP_001026886.1. NM_001031716.2. [Q96AH0-1 ]
    NP_001241665.1. NM_001254736.1. [Q96AH0-2 ]
    UniGenei Hs.591610.

    3D structure databases

    ProteinModelPortali Q96AH0.
    SMRi Q96AH0. Positions 9-101.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122332. 5 interactions.
    STRINGi 9606.ENSP00000403683.

    Polymorphism databases

    DMDMi 74760705.

    Proteomic databases

    MaxQBi Q96AH0.
    PaxDbi Q96AH0.
    PRIDEi Q96AH0.

    Protocols and materials databases

    DNASUi 64859.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000307849 ; ENSP00000307968 ; ENSG00000173559 . [Q96AH0-3 ]
    ENST00000409510 ; ENSP00000386605 ; ENSG00000173559 . [Q96AH0-2 ]
    ENST00000410026 ; ENSP00000387243 ; ENSG00000173559 . [Q96AH0-2 ]
    ENST00000425611 ; ENSP00000403683 ; ENSG00000173559 . [Q96AH0-1 ]
    ENST00000451500 ; ENSP00000390901 ; ENSG00000173559 . [Q96AH0-3 ]
    GeneIDi 64859.
    KEGGi hsa:64859.
    UCSCi uc002usw.3. human. [Q96AH0-1 ]
    uc021vug.1. human. [Q96AH0-2 ]

    Organism-specific databases

    CTDi 64859.
    GeneCardsi GC02P192543.
    H-InvDB HIX0002686.
    HGNCi HGNC:26232. NABP1.
    HPAi HPA054978.
    MIMi 612103. gene.
    neXtProti NX_Q96AH0.
    Orphaneti 520. Acute promyelocytic leukemia.
    PharmGKBi PA143485566.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG285523.
    HOGENOMi HOG000006622.
    InParanoidi Q96AH0.
    OMAi SASARFY.
    PhylomeDBi Q96AH0.
    TreeFami TF313902.

    Miscellaneous databases

    GenomeRNAii 64859.
    NextBioi 67011.
    PROi Q96AH0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96AH0.
    Bgeei Q96AH0.
    CleanExi HS_OBFC2A.
    Genevestigatori Q96AH0.

    Family and domain databases

    Gene3Di 2.40.50.140. 1 hit.
    InterProi IPR012340. NA-bd_OB-fold.
    IPR004365. NA-bd_OB_tRNA.
    [Graphical view ]
    Pfami PF01336. tRNA_anti-codon. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50249. SSF50249. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Ileal mucosa.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Bone marrow.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Uterus.
    6. "hSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response."
      Li Y., Bolderson E., Kumar R., Muniandy P.A., Xue Y., Richard D.J., Seidman M., Pandita T.K., Khanna K.K., Wang W.
      J. Biol. Chem. 284:23525-23531(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX.
    7. "SOSS complexes participate in the maintenance of genomic stability."
      Huang J., Gong Z., Ghosal G., Chen J.
      Mol. Cell 35:384-393(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN THE SOSS COMPLEX, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX.

    Entry informationi

    Entry nameiSOSB2_HUMAN
    AccessioniPrimary (citable) accession number: Q96AH0
    Secondary accession number(s): Q658Y8, Q9H5X6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3