Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96AH0 (SOSB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SOSS complex subunit B2
Alternative name(s):
Nucleic acid-binding protein 1
Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
Sensor of single-strand DNA complex subunit B2
Sensor of ssDNA subunit B2
Short name=SOSS-B2
Single-stranded DNA-binding protein 2
Short name=hSSB2
Gene names
Name:NABP1
Synonyms:OBFC2A, SSB2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length204 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. Ref.6 Ref.7

Subunit structure

Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1. Ref.6 Ref.7

Subcellular location

Nucleus. Note: Localizes to nuclear foci following DNA damage. Ref.6 Ref.7

Sequence similarities

Belongs to the SOSS-B family. SOSS-B2 subfamily.

Contains 1 OB DNA-binding domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96AH0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96AH0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.
Isoform 3 (identifier: Q96AH0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     101-134: EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN → DLGAVQAAAMRDSIHYYPGNDLHPDLEEPSSLGV
     135-204: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 204204SOSS complex subunit B2
PRO_0000333954

Regions

DNA binding26 – 9974OB

Natural variations

Alternative sequence1 – 8080Missing in isoform 2.
VSP_033600
Alternative sequence101 – 13434EFCMV…EQKNN → DLGAVQAAAMRDSIHYYPGN DLHPDLEEPSSLGV in isoform 3.
VSP_033601
Alternative sequence135 – 20470Missing in isoform 3.
VSP_033602
Natural variant1541T → S.
Corresponds to variant rs12612256 [ dbSNP | Ensembl ].
VAR_043340

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: EF7579A452381E47

FASTA20422,423
        10         20         30         40         50         60 
MNRVNDPLIF IRDIKPGLKN LNVVFIVLEI GRVTKTKDGH EVRSCKVADK TGSITISVWD 

        70         80         90        100        110        120 
EIGGLIQPGD IIRLTRGYAS MWKGCLTLYT GRGGELQKIG EFCMVYSEVP NFSEPNPDYR 

       130        140        150        160        170        180 
GQQNKGAQSE QKNNSMNSNM GTGTFGPVGN GVHTGPESRE HQFSHAGRSN GRGLINPQLQ 

       190        200 
GTASNQTVMT TISNGRDPRR AFKR 

« Hide

Isoform 2 [UniParc].

Checksum: 285E087256426CAC
Show »

FASTA12413,579
Isoform 3 [UniParc].

Checksum: 9243CCF90A5E06E2
Show »

FASTA13414,677

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Ileal mucosa.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Bone marrow.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Uterus.
[6]"hSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response."
Li Y., Bolderson E., Kumar R., Muniandy P.A., Xue Y., Richard D.J., Seidman M., Pandita T.K., Khanna K.K., Wang W.
J. Biol. Chem. 284:23525-23531(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX.
[7]"SOSS complexes participate in the maintenance of genomic stability."
Huang J., Gong Z., Ghosal G., Chen J.
Mol. Cell 35:384-393(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN THE SOSS COMPLEX, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SOSS COMPLEX.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK026486 mRNA. Translation: BAB15491.1.
AL832659 mRNA. Translation: CAH56209.1.
AC114778 Genomic DNA. Translation: AAY24348.1.
CH471058 Genomic DNA. Translation: EAX10836.1.
CH471058 Genomic DNA. Translation: EAX10837.1.
CH471058 Genomic DNA. Translation: EAX10838.1.
BC017114 mRNA. Translation: AAH17114.1.
BC107723 mRNA. Translation: AAI07724.1.
CCDSCCDS33352.1. [Q96AH0-1]
CCDS58745.1. [Q96AH0-2]
RefSeqNP_001026886.1. NM_001031716.2. [Q96AH0-1]
NP_001241665.1. NM_001254736.1. [Q96AH0-2]
UniGeneHs.591610.

3D structure databases

ProteinModelPortalQ96AH0.
SMRQ96AH0. Positions 9-101.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122332. 5 interactions.
STRING9606.ENSP00000403683.

Polymorphism databases

DMDM74760705.

Proteomic databases

MaxQBQ96AH0.
PaxDbQ96AH0.
PRIDEQ96AH0.

Protocols and materials databases

DNASU64859.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000307849; ENSP00000307968; ENSG00000173559. [Q96AH0-3]
ENST00000409510; ENSP00000386605; ENSG00000173559. [Q96AH0-2]
ENST00000410026; ENSP00000387243; ENSG00000173559. [Q96AH0-2]
ENST00000425611; ENSP00000403683; ENSG00000173559. [Q96AH0-1]
ENST00000451500; ENSP00000390901; ENSG00000173559. [Q96AH0-3]
GeneID64859.
KEGGhsa:64859.
UCSCuc002usw.3. human. [Q96AH0-1]
uc021vug.1. human. [Q96AH0-2]

Organism-specific databases

CTD64859.
GeneCardsGC02P192543.
H-InvDBHIX0002686.
HGNCHGNC:26232. NABP1.
HPAHPA054978.
MIM612103. gene.
neXtProtNX_Q96AH0.
Orphanet520. Acute promyelocytic leukemia.
PharmGKBPA143485566.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG285523.
HOGENOMHOG000006622.
InParanoidQ96AH0.
OMASASARFY.
PhylomeDBQ96AH0.
TreeFamTF313902.

Gene expression databases

ArrayExpressQ96AH0.
BgeeQ96AH0.
CleanExHS_OBFC2A.
GenevestigatorQ96AH0.

Family and domain databases

Gene3D2.40.50.140. 1 hit.
InterProIPR012340. NA-bd_OB-fold.
IPR004365. NA-bd_OB_tRNA.
[Graphical view]
PfamPF01336. tRNA_anti-codon. 1 hit.
[Graphical view]
SUPFAMSSF50249. SSF50249. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi64859.
NextBio67011.
PROQ96AH0.
SOURCESearch...

Entry information

Entry nameSOSB2_HUMAN
AccessionPrimary (citable) accession number: Q96AH0
Secondary accession number(s): Q658Y8, Q9H5X6
Entry history
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM