Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SOSS complex subunit B2

Gene

NABP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi26 – 99OBAdd BLAST74

GO - Molecular functioni

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • DNA repair Source: UniProtKB
  • double-strand break repair via homologous recombination Source: UniProtKB
  • mitotic cell cycle checkpoint Source: UniProtKB
  • response to ionizing radiation Source: UniProtKB
  • snRNA transcription from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA repair

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173559-MONOMER.
ReactomeiR-HSA-6807505. RNA polymerase II transcribes snRNA genes.

Names & Taxonomyi

Protein namesi
Recommended name:
SOSS complex subunit B2
Alternative name(s):
Nucleic acid-binding protein 1
Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
Sensor of single-strand DNA complex subunit B2
Sensor of ssDNA subunit B2
Short name:
SOSS-B2
Single-stranded DNA-binding protein 2
Short name:
hSSB2
Gene namesi
Name:NABP1
Synonyms:OBFC2A, SSB2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:26232. NABP1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nuclear chromosome, telomeric region Source: BHF-UCL
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • SOSS complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi64859.
MalaCardsiNABP1.
OpenTargetsiENSG00000173559.
Orphaneti520. Acute promyelocytic leukemia.
PharmGKBiPA143485566.

Polymorphism and mutation databases

BioMutaiNABP1.
DMDMi74760705.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003339541 – 204SOSS complex subunit B2Add BLAST204

Proteomic databases

EPDiQ96AH0.
MaxQBiQ96AH0.
PaxDbiQ96AH0.
PeptideAtlasiQ96AH0.
PRIDEiQ96AH0.

Expressioni

Gene expression databases

BgeeiENSG00000173559.
CleanExiHS_OBFC2A.
ExpressionAtlasiQ96AH0. baseline and differential.
GenevisibleiQ96AH0. HS.

Organism-specific databases

HPAiHPA054978.

Interactioni

Subunit structurei

Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
INTS3Q68E015EBI-2889252,EBI-2680854
KHDRBS2Q5VWX13EBI-2889252,EBI-742808
MKRN3Q130643EBI-2889252,EBI-2340269
QKIQ96PU83EBI-2889252,EBI-945792
RBMXP381593EBI-2889252,EBI-743526
TFCP2Q128003EBI-2889252,EBI-717422

Protein-protein interaction databases

BioGridi122332. 18 interactors.
IntActiQ96AH0. 19 interactors.
STRINGi9606.ENSP00000403683.

Structurei

3D structure databases

ProteinModelPortaliQ96AH0.
SMRiQ96AH0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SOSS-B family. SOSS-B2 subfamily.Curated
Contains 1 OB DNA-binding domain.Curated

Phylogenomic databases

eggNOGiKOG3416. Eukaryota.
ENOG4111MBP. LUCA.
GeneTreeiENSGT00390000001913.
HOGENOMiHOG000006622.
InParanoidiQ96AH0.
OMAiHAGRSNG.
OrthoDBiEOG091G0YHH.
PhylomeDBiQ96AH0.
TreeFamiTF313902.

Family and domain databases

InterProiIPR012340. NA-bd_OB-fold.
IPR033550. SOSS-B2.
[Graphical view]
PANTHERiPTHR13356:SF1. PTHR13356:SF1. 1 hit.
SUPFAMiSSF50249. SSF50249. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRVNDPLIF IRDIKPGLKN LNVVFIVLEI GRVTKTKDGH EVRSCKVADK
60 70 80 90 100
TGSITISVWD EIGGLIQPGD IIRLTRGYAS MWKGCLTLYT GRGGELQKIG
110 120 130 140 150
EFCMVYSEVP NFSEPNPDYR GQQNKGAQSE QKNNSMNSNM GTGTFGPVGN
160 170 180 190 200
GVHTGPESRE HQFSHAGRSN GRGLINPQLQ GTASNQTVMT TISNGRDPRR

AFKR
Length:204
Mass (Da):22,423
Last modified:December 1, 2001 - v1
Checksum:iEF7579A452381E47
GO
Isoform 2 (identifier: Q96AH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:124
Mass (Da):13,579
Checksum:i285E087256426CAC
GO
Isoform 3 (identifier: Q96AH0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-134: EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN → DLGAVQAAAMRDSIHYYPGNDLHPDLEEPSSLGV
     135-204: Missing.

Show »
Length:134
Mass (Da):14,677
Checksum:i9243CCF90A5E06E2
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043340154T → S.Corresponds to variant rs12612256dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0336001 – 80Missing in isoform 2. 2 PublicationsAdd BLAST80
Alternative sequenceiVSP_033601101 – 134EFCMV…EQKNN → DLGAVQAAAMRDSIHYYPGN DLHPDLEEPSSLGV in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_033602135 – 204Missing in isoform 3. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026486 mRNA. Translation: BAB15491.1.
AL832659 mRNA. Translation: CAH56209.1.
AC114778 Genomic DNA. Translation: AAY24348.1.
CH471058 Genomic DNA. Translation: EAX10836.1.
CH471058 Genomic DNA. Translation: EAX10837.1.
CH471058 Genomic DNA. Translation: EAX10838.1.
BC017114 mRNA. Translation: AAH17114.1.
BC107723 mRNA. Translation: AAI07724.1.
CCDSiCCDS33352.1. [Q96AH0-1]
CCDS58745.1. [Q96AH0-2]
RefSeqiNP_001026886.1. NM_001031716.2. [Q96AH0-1]
NP_001241665.1. NM_001254736.1. [Q96AH0-2]
XP_016860211.1. XM_017004722.1. [Q96AH0-3]
UniGeneiHs.591610.

Genome annotation databases

EnsembliENST00000307849; ENSP00000307968; ENSG00000173559. [Q96AH0-3]
ENST00000409510; ENSP00000386605; ENSG00000173559. [Q96AH0-2]
ENST00000410026; ENSP00000387243; ENSG00000173559. [Q96AH0-2]
ENST00000425611; ENSP00000403683; ENSG00000173559. [Q96AH0-1]
ENST00000451500; ENSP00000390901; ENSG00000173559. [Q96AH0-3]
GeneIDi64859.
KEGGihsa:64859.
UCSCiuc002usw.4. human. [Q96AH0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026486 mRNA. Translation: BAB15491.1.
AL832659 mRNA. Translation: CAH56209.1.
AC114778 Genomic DNA. Translation: AAY24348.1.
CH471058 Genomic DNA. Translation: EAX10836.1.
CH471058 Genomic DNA. Translation: EAX10837.1.
CH471058 Genomic DNA. Translation: EAX10838.1.
BC017114 mRNA. Translation: AAH17114.1.
BC107723 mRNA. Translation: AAI07724.1.
CCDSiCCDS33352.1. [Q96AH0-1]
CCDS58745.1. [Q96AH0-2]
RefSeqiNP_001026886.1. NM_001031716.2. [Q96AH0-1]
NP_001241665.1. NM_001254736.1. [Q96AH0-2]
XP_016860211.1. XM_017004722.1. [Q96AH0-3]
UniGeneiHs.591610.

3D structure databases

ProteinModelPortaliQ96AH0.
SMRiQ96AH0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122332. 18 interactors.
IntActiQ96AH0. 19 interactors.
STRINGi9606.ENSP00000403683.

Polymorphism and mutation databases

BioMutaiNABP1.
DMDMi74760705.

Proteomic databases

EPDiQ96AH0.
MaxQBiQ96AH0.
PaxDbiQ96AH0.
PeptideAtlasiQ96AH0.
PRIDEiQ96AH0.

Protocols and materials databases

DNASUi64859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307849; ENSP00000307968; ENSG00000173559. [Q96AH0-3]
ENST00000409510; ENSP00000386605; ENSG00000173559. [Q96AH0-2]
ENST00000410026; ENSP00000387243; ENSG00000173559. [Q96AH0-2]
ENST00000425611; ENSP00000403683; ENSG00000173559. [Q96AH0-1]
ENST00000451500; ENSP00000390901; ENSG00000173559. [Q96AH0-3]
GeneIDi64859.
KEGGihsa:64859.
UCSCiuc002usw.4. human. [Q96AH0-1]

Organism-specific databases

CTDi64859.
DisGeNETi64859.
GeneCardsiNABP1.
H-InvDBHIX0002686.
HGNCiHGNC:26232. NABP1.
HPAiHPA054978.
MalaCardsiNABP1.
MIMi612103. gene.
neXtProtiNX_Q96AH0.
OpenTargetsiENSG00000173559.
Orphaneti520. Acute promyelocytic leukemia.
PharmGKBiPA143485566.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3416. Eukaryota.
ENOG4111MBP. LUCA.
GeneTreeiENSGT00390000001913.
HOGENOMiHOG000006622.
InParanoidiQ96AH0.
OMAiHAGRSNG.
OrthoDBiEOG091G0YHH.
PhylomeDBiQ96AH0.
TreeFamiTF313902.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173559-MONOMER.
ReactomeiR-HSA-6807505. RNA polymerase II transcribes snRNA genes.

Miscellaneous databases

GenomeRNAii64859.
PROiQ96AH0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000173559.
CleanExiHS_OBFC2A.
ExpressionAtlasiQ96AH0. baseline and differential.
GenevisibleiQ96AH0. HS.

Family and domain databases

InterProiIPR012340. NA-bd_OB-fold.
IPR033550. SOSS-B2.
[Graphical view]
PANTHERiPTHR13356:SF1. PTHR13356:SF1. 1 hit.
SUPFAMiSSF50249. SSF50249. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSOSB2_HUMAN
AccessioniPrimary (citable) accession number: Q96AH0
Secondary accession number(s): Q658Y8, Q9H5X6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.