Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tetratricopeptide repeat protein 17

Gene

TTC17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in primary ciliogenesis by modulating actin polymerization.1 Publication

GO - Biological processi

  • actin filament polymerization Source: UniProtKB
  • cilium organization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Tetratricopeptide repeat protein 17
Short name:
TPR repeat protein 17
Gene namesi
Name:TTC17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:25596. TTC17.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134912435.

Polymorphism and mutation databases

BioMutaiTTC17.
DMDMi52783467.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11411141Tetratricopeptide repeat protein 17PRO_0000106406Add
BLAST

Proteomic databases

EPDiQ96AE7.
MaxQBiQ96AE7.
PaxDbiQ96AE7.
PeptideAtlasiQ96AE7.
PRIDEiQ96AE7.

PTM databases

iPTMnetiQ96AE7.
PhosphoSiteiQ96AE7.

Expressioni

Tissue specificityi

Expressed in germ cells as well as in somatic cells of the testis (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000052841.
CleanExiHS_TTC17.
ExpressionAtlasiQ96AE7. baseline and differential.
GenevisibleiQ96AE7. HS.

Organism-specific databases

HPAiHPA038508.

Interactioni

Subunit structurei

Interacts with CATIP.1 Publication

Protein-protein interaction databases

BioGridi120879. 27 interactions.
IntActiQ96AE7. 2 interactions.
STRINGi9606.ENSP00000039989.

Structurei

3D structure databases

ProteinModelPortaliQ96AE7.
SMRiQ96AE7. Positions 275-315, 620-732.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati295 – 32834TPR 1Add
BLAST
Repeati619 – 65234TPR 2Add
BLAST
Repeati689 – 72234TPR 3Add
BLAST
Repeati1014 – 104835TPR 4Add
BLAST
Repeati1051 – 108434TPR 5Add
BLAST
Repeati1085 – 111834TPR 6Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili340 – 38243Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TTC17 family.Curated
Contains 6 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG4507. Eukaryota.
ENOG410XSDX. LUCA.
GeneTreeiENSGT00390000006196.
HOGENOMiHOG000231397.
HOVERGENiHBG061973.
InParanoidiQ96AE7.
OMAiILMRQET.
OrthoDBiEOG091G04D0.
PhylomeDBiQ96AE7.
TreeFamiTF315005.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13181. TPR_8. 2 hits.
[Graphical view]
SMARTiSM00028. TPR. 7 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 4 hits.
PS50293. TPR_REGION. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAVGVRGR YELPPCSGPG WLLSLSALLS VAARGAFATT HWVVTEDGKI
60 70 80 90 100
QQQVDSPMNL KHPHDLVILM RQEATVNYLK ELEKQLVAQK IHIEENEDRD
110 120 130 140 150
TGLEQRHNKE DPDCIKAKVP LGDLDLYDGT YITLESKDIS PEDYIDTESP
160 170 180 190 200
VPPDPEQPDC TKILELPYSI HAFQHLRGVQ ERVNLSAPLL PKEDPIFTYL
210 220 230 240 250
SKRLGRSIDD IGHLIHEGLQ KNTSSWVLYN MASFYWRIKN EPYQVVECAM
260 270 280 290 300
RALHFSSRHN KDIALVNLAN VLHRAHFSAD AAVVVHAALD DSDFFTSYYT
310 320 330 340 350
LGNIYAMLGE YNHSVLCYDH ALQARPGFEQ AIKRKHAVLC QQKLEQKLEA
360 370 380 390 400
QHRSLQRTLN ELKEYQKQHD HYLRQQEILE KHKLIQEEQI LRNIIHETQM
410 420 430 440 450
AKEAQLGNHQ ICRLVNQQHS LHCQWDQPVR YHRGDIFENV DYVQFGEDSS
460 470 480 490 500
TSSMMSVNFD VQSNQSDIND SVKSSPVAHS ILWIWGRDSD AYRDKQHILW
510 520 530 540 550
PKRADCTESY PRVPVGGELP TYFLPPENKG LRIHELSSDD YSTEEEAQTP
560 570 580 590 600
DCSITDFRKS HTLSYLVKEL EVRMDLKAKM PDDHARKILL SRINNYTIPE
610 620 630 640 650
EEIGSFLFHA INKPNAPIWL ILNEAGLYWR AVGNSTFAIA CLQRALNLAP
660 670 680 690 700
LQYQDVPLVN LANLLIHYGL HLDATKLLLQ ALAINSSEPL TFLSLGNAYL
710 720 730 740 750
ALKNISGALE AFRQALKLTT KCPECENSLK LIRCMQFYPF LYNITSSVCS
760 770 780 790 800
GTVVEESNGS DEMENSDETK MSEEILALVD EFQQAWPLEG FGGALEMKGR
810 820 830 840 850
RLDLQGIRVL KKGPQDGVAR SSCYGDCRSE DDEATEWITF QVKRVKKPKG
860 870 880 890 900
DHKKTPGKKV ETGQIENGHR YQANLEITGP KVASPGPQGK KRDYQRLGWP
910 920 930 940 950
SPDECLKLRW VELTAIVSTW LAVSSKNIDI TEHIDFATPI QQPAMEPLCN
960 970 980 990 1000
GNLPTSMHTL DHLHGVSNRA SLHYTGESQL TEVLQNLGKD QYPQQSLEQI
1010 1020 1030 1040 1050
GTRIAKVLEK NQTSWVLSSM AALYWRVKGQ GKKAIDCLRQ ALHYAPHQMK
1060 1070 1080 1090 1100
DVPLISLANI LHNAKLWNDA VIVATMAVEI APHFAVNHFT LGNVYVAMEE
1110 1120 1130 1140
FEKALVWYES TLKLQPEFVP AKNRIQTIQC HLMLKKGRRS P
Length:1,141
Mass (Da):129,558
Last modified:December 1, 2001 - v1
Checksum:i728A031FED8BDE3E
GO
Isoform 2 (identifier: Q96AE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-751: G → GNCHEKTLDNSHDKQKYFDNSQSLDAAEEEPSERGTEEDPVFSVENSGRDSDALRLES
     890-898: KKRDYQRLG → LLDWKTRKV
     899-1140: Missing.

Note: No experimental confirmation available.
Show »
Length:956
Mass (Da):108,613
Checksum:iC608CAFE900AAE1D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 2 (identifier: Q96AE7-2)
Sequence conflicti787 – 7871E → G in AAH33000 (PubMed:15489334).

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti145 – 1451I → L.
Corresponds to variant rs12099204 [ dbSNP | Ensembl ].
VAR_034135
Natural varianti270 – 2701N → H.
Corresponds to variant rs16937479 [ dbSNP | Ensembl ].
VAR_052627

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei751 – 7511G → GNCHEKTLDNSHDKQKYFDN SQSLDAAEEEPSERGTEEDP VFSVENSGRDSDALRLES in isoform 2. 1 PublicationVSP_056857
Alternative sequencei890 – 8989KKRDYQRLG → LLDWKTRKV in isoform 2. 1 PublicationVSP_056858
Alternative sequencei899 – 1140242Missing in isoform 2. 1 PublicationVSP_056859Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC023085 Genomic DNA. No translation available.
AC087276 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68094.1.
BC017238 mRNA. Translation: AAH17238.1.
BC033000 mRNA. Translation: AAH33000.1.
CCDSiCCDS31466.1. [Q96AE7-1]
CCDS76396.1. [Q96AE7-2]
RefSeqiNP_001294872.1. NM_001307943.1. [Q96AE7-2]
NP_060729.2. NM_018259.5. [Q96AE7-1]
UniGeneiHs.191186.

Genome annotation databases

EnsembliENST00000039989; ENSP00000039989; ENSG00000052841. [Q96AE7-1]
ENST00000299240; ENSP00000299240; ENSG00000052841. [Q96AE7-2]
GeneIDi55761.
KEGGihsa:55761.
UCSCiuc001mxh.4. human. [Q96AE7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC023085 Genomic DNA. No translation available.
AC087276 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68094.1.
BC017238 mRNA. Translation: AAH17238.1.
BC033000 mRNA. Translation: AAH33000.1.
CCDSiCCDS31466.1. [Q96AE7-1]
CCDS76396.1. [Q96AE7-2]
RefSeqiNP_001294872.1. NM_001307943.1. [Q96AE7-2]
NP_060729.2. NM_018259.5. [Q96AE7-1]
UniGeneiHs.191186.

3D structure databases

ProteinModelPortaliQ96AE7.
SMRiQ96AE7. Positions 275-315, 620-732.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120879. 27 interactions.
IntActiQ96AE7. 2 interactions.
STRINGi9606.ENSP00000039989.

PTM databases

iPTMnetiQ96AE7.
PhosphoSiteiQ96AE7.

Polymorphism and mutation databases

BioMutaiTTC17.
DMDMi52783467.

Proteomic databases

EPDiQ96AE7.
MaxQBiQ96AE7.
PaxDbiQ96AE7.
PeptideAtlasiQ96AE7.
PRIDEiQ96AE7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000039989; ENSP00000039989; ENSG00000052841. [Q96AE7-1]
ENST00000299240; ENSP00000299240; ENSG00000052841. [Q96AE7-2]
GeneIDi55761.
KEGGihsa:55761.
UCSCiuc001mxh.4. human. [Q96AE7-1]

Organism-specific databases

CTDi55761.
GeneCardsiTTC17.
HGNCiHGNC:25596. TTC17.
HPAiHPA038508.
neXtProtiNX_Q96AE7.
PharmGKBiPA134912435.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4507. Eukaryota.
ENOG410XSDX. LUCA.
GeneTreeiENSGT00390000006196.
HOGENOMiHOG000231397.
HOVERGENiHBG061973.
InParanoidiQ96AE7.
OMAiILMRQET.
OrthoDBiEOG091G04D0.
PhylomeDBiQ96AE7.
TreeFamiTF315005.

Miscellaneous databases

ChiTaRSiTTC17. human.
GenomeRNAii55761.
PROiQ96AE7.

Gene expression databases

BgeeiENSG00000052841.
CleanExiHS_TTC17.
ExpressionAtlasiQ96AE7. baseline and differential.
GenevisibleiQ96AE7. HS.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13181. TPR_8. 2 hits.
[Graphical view]
SMARTiSM00028. TPR. 7 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 4 hits.
PS50293. TPR_REGION. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTTC17_HUMAN
AccessioniPrimary (citable) accession number: Q96AE7
Secondary accession number(s): G3XAB3, Q8NEC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.