Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96AA8

- JKIP2_HUMAN

UniProt

Q96AA8 - JKIP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Janus kinase and microtubule-interacting protein 2

Gene

JAKMIP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Janus kinase and microtubule-interacting protein 2
Alternative name(s):
CTCL tumor antigen HD-CL-04
Neuroendocrine long coiled-coil protein 1
Gene namesi
Name:JAKMIP2
Synonyms:JAMIP2, KIAA0555, NECC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:29067. JAKMIP2.

Subcellular locationi

Golgi apparatus 1 Publication

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485509.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 810810Janus kinase and microtubule-interacting protein 2PRO_0000050762Add
BLAST

Proteomic databases

PaxDbiQ96AA8.
PRIDEiQ96AA8.

PTM databases

PhosphoSiteiQ96AA8.

Expressioni

Tissue specificityi

Highly expressed in brain, moderately expressed in thymus, spleen and lung, and weakly expressed in kidney, liver and peripheral blood lymphocytes. Also expressed in adrenal and pituitary glands, as well as testis.2 Publications

Gene expression databases

BgeeiQ96AA8.
CleanExiHS_JAKMIP2.
ExpressionAtlasiQ96AA8. baseline and differential.
GenevestigatoriQ96AA8.

Organism-specific databases

HPAiHPA046929.

Interactioni

Protein-protein interaction databases

BioGridi115170. 1 interaction.
IntActiQ96AA8. 1 interaction.
MINTiMINT-1445731.
STRINGi9606.ENSP00000265272.

Structurei

3D structure databases

ProteinModelPortaliQ96AA8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili13 – 10290Sequence AnalysisAdd
BLAST
Coiled coili148 – 17831Sequence AnalysisAdd
BLAST
Coiled coili207 – 24438Sequence AnalysisAdd
BLAST
Coiled coili280 – 419140Sequence AnalysisAdd
BLAST
Coiled coili468 – 597130Sequence AnalysisAdd
BLAST
Coiled coili664 – 808145Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the JAKMIP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG147883.
GeneTreeiENSGT00390000002812.
HOGENOMiHOG000060161.
HOVERGENiHBG054249.
InParanoidiQ96AA8.
OMAiCLTKRND.
PhylomeDBiQ96AA8.
TreeFamiTF331900.

Family and domain databases

InterProiIPR024836. JAKMIP.
[Graphical view]
PANTHERiPTHR18935. PTHR18935. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96AA8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKKGRNKGE KPEALIVALQ AANEDLRTKL TDIQIELHQE KSKVSKLERE
60 70 80 90 100
KTQEAKRIRE LEQRKHTVLV TELKAKLHEE KMKELQAVRE NLIKQHEQEM
110 120 130 140 150
SRTVKVRDGE IQRLKSALCA LRDGSSDKVR TALTIEAREE ARKLFDTERL
160 170 180 190 200
KLLQEIADLK TAKKQVDEAL SNMIQADKIK AGDLRSEHQS HQEAISKIKW
210 220 230 240 250
ESERDIRRLM DEIKAKDRII FSLEKELETQ TGYVQKLQLQ KEALDEQLFL
260 270 280 290 300
VKEAECNMSS PKREIPGRAG DGSEHCSSPD LRRNQKRIAE LNATIRKLED
310 320 330 340 350
RNTLLGDERN ELLKRVRETE KQCKPLLERN KCLAKRNDEL MVSLQRMEEK
360 370 380 390 400
LKAVTKENSE MREKITSHPP LKKLKSLNDL DQANEEQETE FLKLQVIEQQ
410 420 430 440 450
NIIDELTRDR EKLIRRRKHR RSSKPIKRPV LDPFIGYDED SMDSETSSMA
460 470 480 490 500
SFRTDRTPAT PDDDLDESLA AEESELRFRQ LTKEYQALQR AYALLQEQTG
510 520 530 540 550
GIIDAEREAK AQEQLQAEVL RYKAKIEDLE ATLAQKGQDS HWVEDKQLFI
560 570 580 590 600
KRNQELLEKI EKQEAENHRL QQELQDARDQ NELLEFRNLE LEERERRSPP
610 620 630 640 650
FNLQIHPFSD GVSALQIYCM KEGVKDVNIP DLIKQLDILG DNGNLRNEEQ
660 670 680 690 700
VAIIQASTVL SLAEKWIQQI EGAEAALHQK MMELESDMEQ FCKIKGYLEE
710 720 730 740 750
ELDYRKQALD QAYMRIQELE ATLYNALQQE TVIKFGELLS EKQQEELRTA
760 770 780 790 800
VEKLRRQMLR KSREYDCQIL QERMELLQQA HQRIRDLEDK TDIQKRQIKD
810
LEEKSNRKHG
Length:810
Mass (Da):94,934
Last modified:December 1, 2001 - v1
Checksum:iD81480AD76DA6A10
GO
Isoform 2 (identifier: Q96AA8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     539-559: Missing.
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:799
Mass (Da):93,620
Checksum:i40CD6861B348F2C4
GO
Isoform 3 (identifier: Q96AA8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:820
Mass (Da):96,258
Checksum:i7C1D5257F1E325AE
GO
Isoform 4 (identifier: Q96AA8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSK → M
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Note: No experimental confirmation available.

Show »
Length:778
Mass (Da):91,546
Checksum:i452F8ED6B1F72BA4
GO

Sequence cautioni

The sequence BAA25481.2 differs from that shown. Reason: Frameshift at position 805. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti106 – 1061V → I.
Corresponds to variant rs3749736 [ dbSNP | Ensembl ].
VAR_022059
Natural varianti315 – 3151R → C in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035930

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4343MSKKG…QEKSK → M in isoform 4. 1 PublicationVSP_055264Add
BLAST
Alternative sequencei539 – 55921Missing in isoform 2. 1 PublicationVSP_002430Add
BLAST
Alternative sequencei805 – 8106SNRKHG → FLFLFLFFSLAFILWP in isoform 2, isoform 3 and isoform 4. 3 PublicationsVSP_028230

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291280 mRNA. Translation: BAF83969.1.
AK299724 mRNA. Translation: BAG61622.1.
EF512550 mRNA. Translation: ABP62932.1.
AF273057 mRNA. Translation: AAM44460.1.
AB011127 mRNA. Translation: BAA25481.2. Frameshift.
AC011370 Genomic DNA. No translation available.
AC011415 Genomic DNA. No translation available.
AC126775 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61820.1.
CH471062 Genomic DNA. Translation: EAW61821.1.
BC017354 mRNA. Translation: AAH17354.1.
CCDSiCCDS4285.1. [Q96AA8-1]
CCDS59495.1. [Q96AA8-2]
CCDS64284.1. [Q96AA8-4]
CCDS75352.1. [Q96AA8-3]
PIRiT00331.
RefSeqiNP_001257863.1. NM_001270934.1. [Q96AA8-2]
NP_001257870.1. NM_001270941.1. [Q96AA8-3]
NP_001269211.1. NM_001282282.1. [Q96AA8-4]
NP_055605.2. NM_014790.4. [Q96AA8-1]
UniGeneiHs.740461.
Hs.744926.

Genome annotation databases

EnsembliENST00000265272; ENSP00000265272; ENSG00000176049. [Q96AA8-1]
ENST00000333010; ENSP00000328989; ENSG00000176049. [Q96AA8-4]
ENST00000507386; ENSP00000421398; ENSG00000176049. [Q96AA8-2]
ENST00000616793; ENSP00000479248; ENSG00000176049. [Q96AA8-3]
GeneIDi9832.
KEGGihsa:9832.
UCSCiuc003loq.2. human. [Q96AA8-1]
uc010jgo.2. human. [Q96AA8-3]

Polymorphism databases

DMDMi20140696.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291280 mRNA. Translation: BAF83969.1 .
AK299724 mRNA. Translation: BAG61622.1 .
EF512550 mRNA. Translation: ABP62932.1 .
AF273057 mRNA. Translation: AAM44460.1 .
AB011127 mRNA. Translation: BAA25481.2 . Frameshift.
AC011370 Genomic DNA. No translation available.
AC011415 Genomic DNA. No translation available.
AC126775 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61820.1 .
CH471062 Genomic DNA. Translation: EAW61821.1 .
BC017354 mRNA. Translation: AAH17354.1 .
CCDSi CCDS4285.1. [Q96AA8-1 ]
CCDS59495.1. [Q96AA8-2 ]
CCDS64284.1. [Q96AA8-4 ]
CCDS75352.1. [Q96AA8-3 ]
PIRi T00331.
RefSeqi NP_001257863.1. NM_001270934.1. [Q96AA8-2 ]
NP_001257870.1. NM_001270941.1. [Q96AA8-3 ]
NP_001269211.1. NM_001282282.1. [Q96AA8-4 ]
NP_055605.2. NM_014790.4. [Q96AA8-1 ]
UniGenei Hs.740461.
Hs.744926.

3D structure databases

ProteinModelPortali Q96AA8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115170. 1 interaction.
IntActi Q96AA8. 1 interaction.
MINTi MINT-1445731.
STRINGi 9606.ENSP00000265272.

PTM databases

PhosphoSitei Q96AA8.

Polymorphism databases

DMDMi 20140696.

Proteomic databases

PaxDbi Q96AA8.
PRIDEi Q96AA8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265272 ; ENSP00000265272 ; ENSG00000176049 . [Q96AA8-1 ]
ENST00000333010 ; ENSP00000328989 ; ENSG00000176049 . [Q96AA8-4 ]
ENST00000507386 ; ENSP00000421398 ; ENSG00000176049 . [Q96AA8-2 ]
ENST00000616793 ; ENSP00000479248 ; ENSG00000176049 . [Q96AA8-3 ]
GeneIDi 9832.
KEGGi hsa:9832.
UCSCi uc003loq.2. human. [Q96AA8-1 ]
uc010jgo.2. human. [Q96AA8-3 ]

Organism-specific databases

CTDi 9832.
GeneCardsi GC05M146949.
HGNCi HGNC:29067. JAKMIP2.
HPAi HPA046929.
MIMi 611197. gene.
neXtProti NX_Q96AA8.
PharmGKBi PA143485509.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG147883.
GeneTreei ENSGT00390000002812.
HOGENOMi HOG000060161.
HOVERGENi HBG054249.
InParanoidi Q96AA8.
OMAi CLTKRND.
PhylomeDBi Q96AA8.
TreeFami TF331900.

Miscellaneous databases

ChiTaRSi JAKMIP2. human.
GenomeRNAii 9832.
NextBioi 35474653.
PROi Q96AA8.
SOURCEi Search...

Gene expression databases

Bgeei Q96AA8.
CleanExi HS_JAKMIP2.
ExpressionAtlasi Q96AA8. baseline and differential.
Genevestigatori Q96AA8.

Family and domain databases

InterProi IPR024836. JAKMIP.
[Graphical view ]
PANTHERi PTHR18935. PTHR18935. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Brain.
  2. "Identification and characterization of two novel (neuro)endocrine long coiled-coil proteins."
    Cruz-Garcia D., Vazquez-Martinez R., Peinado J.R., Anouar Y., Tonon M.C., Vaudry H., Castano J.P., Malagon M.M.
    FEBS Lett. 581:3149-3156(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Cervix carcinoma.
  3. "SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma."
    Hartmann T.B., Thiel D., Dummer R., Schadendorf D., Eichmueller S.
    Br. J. Dermatol. 150:252-258(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: T-cell lymphoma.
  4. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle.
  8. "Jamip1 (marlin-1) defines a family of proteins interacting with Janus kinases and microtubules."
    Steindler C., Li Z., Algarte M., Alcover A., Libri V., Ragimbeau J., Pellegrini S.
    J. Biol. Chem. 279:43168-43177(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-315.

Entry informationi

Entry nameiJKIP2_HUMAN
AccessioniPrimary (citable) accession number: Q96AA8
Secondary accession number(s): A4ZZA7
, A8K5G5, B4DSG0, G5E9Y0, O60302, Q548S1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3