Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96AA8 (JKIP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Janus kinase and microtubule-interacting protein 2
Alternative name(s):
CTCL tumor antigen HD-CL-04
Neuroendocrine long coiled-coil protein 1
Gene names
Name:JAKMIP2
Synonyms:JAMIP2, KIAA0555, NECC1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length810 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Golgi apparatus Ref.2.

Tissue specificity

Highly expressed in brain, moderately expressed in thymus, spleen and lung, and weakly expressed in kidney, liver and peripheral blood lymphocytes. Also expressed in adrenal and pituitary glands, as well as testis. Ref.2 Ref.8

Sequence similarities

Belongs to the JAKMIP family.

Sequence caution

The sequence BAA25481.2 differs from that shown. Reason: Frameshift at position 805.

Ontologies

Keywords
   Cellular componentGolgi apparatus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentGolgi apparatus

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96AA8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96AA8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     539-559: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96AA8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     805-810: SNRKHG → FLFLFLFFSLAFILWP
Isoform 4 (identifier: Q96AA8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSK → M
     805-810: SNRKHG → FLFLFLFFSLAFILWP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 810810Janus kinase and microtubule-interacting protein 2
PRO_0000050762

Regions

Coiled coil13 – 10290 Potential
Coiled coil148 – 17831 Potential
Coiled coil207 – 24438 Potential
Coiled coil280 – 419140 Potential
Coiled coil468 – 597130 Potential
Coiled coil664 – 808145 Potential

Natural variations

Alternative sequence1 – 4343MSKKG…QEKSK → M in isoform 4.
VSP_055264
Alternative sequence539 – 55921Missing in isoform 2.
VSP_002430
Alternative sequence805 – 8106SNRKHG → FLFLFLFFSLAFILWP in isoform 3 and isoform 4.
VSP_028230
Natural variant1061V → I.
Corresponds to variant rs3749736 [ dbSNP | Ensembl ].
VAR_022059
Natural variant3151R → C in a colorectal cancer sample; somatic mutation. Ref.9
VAR_035930

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: D81480AD76DA6A10

FASTA81094,934
        10         20         30         40         50         60 
MSKKGRNKGE KPEALIVALQ AANEDLRTKL TDIQIELHQE KSKVSKLERE KTQEAKRIRE 

        70         80         90        100        110        120 
LEQRKHTVLV TELKAKLHEE KMKELQAVRE NLIKQHEQEM SRTVKVRDGE IQRLKSALCA 

       130        140        150        160        170        180 
LRDGSSDKVR TALTIEAREE ARKLFDTERL KLLQEIADLK TAKKQVDEAL SNMIQADKIK 

       190        200        210        220        230        240 
AGDLRSEHQS HQEAISKIKW ESERDIRRLM DEIKAKDRII FSLEKELETQ TGYVQKLQLQ 

       250        260        270        280        290        300 
KEALDEQLFL VKEAECNMSS PKREIPGRAG DGSEHCSSPD LRRNQKRIAE LNATIRKLED 

       310        320        330        340        350        360 
RNTLLGDERN ELLKRVRETE KQCKPLLERN KCLAKRNDEL MVSLQRMEEK LKAVTKENSE 

       370        380        390        400        410        420 
MREKITSHPP LKKLKSLNDL DQANEEQETE FLKLQVIEQQ NIIDELTRDR EKLIRRRKHR 

       430        440        450        460        470        480 
RSSKPIKRPV LDPFIGYDED SMDSETSSMA SFRTDRTPAT PDDDLDESLA AEESELRFRQ 

       490        500        510        520        530        540 
LTKEYQALQR AYALLQEQTG GIIDAEREAK AQEQLQAEVL RYKAKIEDLE ATLAQKGQDS 

       550        560        570        580        590        600 
HWVEDKQLFI KRNQELLEKI EKQEAENHRL QQELQDARDQ NELLEFRNLE LEERERRSPP 

       610        620        630        640        650        660 
FNLQIHPFSD GVSALQIYCM KEGVKDVNIP DLIKQLDILG DNGNLRNEEQ VAIIQASTVL 

       670        680        690        700        710        720 
SLAEKWIQQI EGAEAALHQK MMELESDMEQ FCKIKGYLEE ELDYRKQALD QAYMRIQELE 

       730        740        750        760        770        780 
ATLYNALQQE TVIKFGELLS EKQQEELRTA VEKLRRQMLR KSREYDCQIL QERMELLQQA 

       790        800        810 
HQRIRDLEDK TDIQKRQIKD LEEKSNRKHG 

« Hide

Isoform 2 [UniParc].

Checksum: F29E58996FBA5A3A
Show »

FASTA78992,296
Isoform 3 [UniParc].

Checksum: 7C1D5257F1E325AE
Show »

FASTA82096,258
Isoform 4 [UniParc].

Checksum: 452F8ED6B1F72BA4
Show »

FASTA77891,546

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Tissue: Brain.
[2]"Identification and characterization of two novel (neuro)endocrine long coiled-coil proteins."
Cruz-Garcia D., Vazquez-Martinez R., Peinado J.R., Anouar Y., Tonon M.C., Vaudry H., Castano J.P., Malagon M.M.
FEBS Lett. 581:3149-3156(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Cervix carcinoma.
[3]"SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma."
Hartmann T.B., Thiel D., Dummer R., Schadendorf D., Eichmueller S.
Br. J. Dermatol. 150:252-258(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: T-cell lymphoma.
[4]"Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[5]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Muscle.
[8]"Jamip1 (marlin-1) defines a family of proteins interacting with Janus kinases and microtubules."
Steindler C., Li Z., Algarte M., Alcover A., Libri V., Ragimbeau J., Pellegrini S.
J. Biol. Chem. 279:43168-43177(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-315.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK291280 mRNA. Translation: BAF83969.1.
AK299724 mRNA. Translation: BAG61622.1.
EF512550 mRNA. Translation: ABP62932.1.
AF273057 mRNA. Translation: AAM44460.1.
AB011127 mRNA. Translation: BAA25481.2. Frameshift.
AC011370 Genomic DNA. No translation available.
AC011415 Genomic DNA. No translation available.
AC126775 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61820.1.
BC017354 mRNA. Translation: AAH17354.1.
CCDSCCDS4285.1. [Q96AA8-1]
PIRT00331.
RefSeqNP_001257863.1. NM_001270934.1.
NP_001257870.1. NM_001270941.1. [Q96AA8-3]
NP_001269211.1. NM_001282282.1.
NP_055605.2. NM_014790.4. [Q96AA8-1]
UniGeneHs.740461.
Hs.744926.

3D structure databases

ProteinModelPortalQ96AA8.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115170. 1 interaction.
IntActQ96AA8. 1 interaction.
MINTMINT-1445731.
STRING9606.ENSP00000265272.

PTM databases

PhosphoSiteQ96AA8.

Polymorphism databases

DMDM20140696.

Proteomic databases

PaxDbQ96AA8.
PRIDEQ96AA8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265272; ENSP00000265272; ENSG00000176049. [Q96AA8-1]
ENST00000333010; ENSP00000328989; ENSG00000176049.
GeneID9832.
KEGGhsa:9832.
UCSCuc003loq.2. human. [Q96AA8-1]
uc010jgo.2. human. [Q96AA8-3]

Organism-specific databases

CTD9832.
GeneCardsGC05M146949.
HGNCHGNC:29067. JAKMIP2.
HPAHPA046929.
MIM611197. gene.
neXtProtNX_Q96AA8.
PharmGKBPA143485509.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG147883.
HOGENOMHOG000060161.
HOVERGENHBG054249.
OMACLTKRND.
PhylomeDBQ96AA8.
TreeFamTF331900.

Gene expression databases

ArrayExpressQ96AA8.
BgeeQ96AA8.
CleanExHS_JAKMIP2.
GenevestigatorQ96AA8.

Family and domain databases

InterProIPR024836. JAKMIP.
[Graphical view]
PANTHERPTHR18935. PTHR18935. 1 hit.
ProtoNetSearch...

Other

ChiTaRSJAKMIP2. human.
GenomeRNAi9832.
NextBio37050.
PROQ96AA8.
SOURCESearch...

Entry information

Entry nameJKIP2_HUMAN
AccessionPrimary (citable) accession number: Q96AA8
Secondary accession number(s): A4ZZA7 expand/collapse secondary AC list , A8K5G5, B4DSG0, O60302, Q548S1
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM