Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Janus kinase and microtubule-interacting protein 2

Gene

JAKMIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Janus kinase and microtubule-interacting protein 2
Alternative name(s):
CTCL tumor antigen HD-CL-04
Neuroendocrine long coiled-coil protein 1
Gene namesi
Name:JAKMIP2
Synonyms:JAMIP2, KIAA0555, NECC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:29067. JAKMIP2.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9832.
OpenTargetsiENSG00000176049.
PharmGKBiPA143485509.

Polymorphism and mutation databases

BioMutaiJAKMIP2.
DMDMi20140696.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000507621 – 810Janus kinase and microtubule-interacting protein 2Add BLAST810

Proteomic databases

MaxQBiQ96AA8.
PaxDbiQ96AA8.
PeptideAtlasiQ96AA8.
PRIDEiQ96AA8.

PTM databases

iPTMnetiQ96AA8.
PhosphoSitePlusiQ96AA8.

Expressioni

Tissue specificityi

Highly expressed in brain, moderately expressed in thymus, spleen and lung, and weakly expressed in kidney, liver and peripheral blood lymphocytes. Also expressed in adrenal and pituitary glands, as well as testis.2 Publications

Gene expression databases

BgeeiENSG00000176049.
CleanExiHS_JAKMIP2.
GenevisibleiQ96AA8. HS.

Organism-specific databases

HPAiHPA046929.
HPA065023.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115170. 13 interactors.
IntActiQ96AA8. 19 interactors.
MINTiMINT-1445731.
STRINGi9606.ENSP00000265272.

Structurei

3D structure databases

SMRiQ96AA8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili13 – 102Sequence analysisAdd BLAST90
Coiled coili148 – 178Sequence analysisAdd BLAST31
Coiled coili207 – 244Sequence analysisAdd BLAST38
Coiled coili280 – 419Sequence analysisAdd BLAST140
Coiled coili468 – 597Sequence analysisAdd BLAST130
Coiled coili664 – 808Sequence analysisAdd BLAST145

Sequence similaritiesi

Belongs to the JAKMIP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410II6X. Eukaryota.
ENOG4110F4A. LUCA.
GeneTreeiENSGT00390000002812.
HOGENOMiHOG000060161.
HOVERGENiHBG054249.
InParanoidiQ96AA8.
OMAiCLTKRND.
OrthoDBiEOG091G024X.
PhylomeDBiQ96AA8.
TreeFamiTF331900.

Family and domain databases

InterProiView protein in InterPro
IPR024836. JAKMIP.
IPR031994. JAKMIP_C.
PANTHERiPTHR18935. PTHR18935. 1 hit.
PfamiView protein in Pfam
PF16034. JAKMIP_CC3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96AA8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKKGRNKGE KPEALIVALQ AANEDLRTKL TDIQIELHQE KSKVSKLERE
60 70 80 90 100
KTQEAKRIRE LEQRKHTVLV TELKAKLHEE KMKELQAVRE NLIKQHEQEM
110 120 130 140 150
SRTVKVRDGE IQRLKSALCA LRDGSSDKVR TALTIEAREE ARKLFDTERL
160 170 180 190 200
KLLQEIADLK TAKKQVDEAL SNMIQADKIK AGDLRSEHQS HQEAISKIKW
210 220 230 240 250
ESERDIRRLM DEIKAKDRII FSLEKELETQ TGYVQKLQLQ KEALDEQLFL
260 270 280 290 300
VKEAECNMSS PKREIPGRAG DGSEHCSSPD LRRNQKRIAE LNATIRKLED
310 320 330 340 350
RNTLLGDERN ELLKRVRETE KQCKPLLERN KCLAKRNDEL MVSLQRMEEK
360 370 380 390 400
LKAVTKENSE MREKITSHPP LKKLKSLNDL DQANEEQETE FLKLQVIEQQ
410 420 430 440 450
NIIDELTRDR EKLIRRRKHR RSSKPIKRPV LDPFIGYDED SMDSETSSMA
460 470 480 490 500
SFRTDRTPAT PDDDLDESLA AEESELRFRQ LTKEYQALQR AYALLQEQTG
510 520 530 540 550
GIIDAEREAK AQEQLQAEVL RYKAKIEDLE ATLAQKGQDS HWVEDKQLFI
560 570 580 590 600
KRNQELLEKI EKQEAENHRL QQELQDARDQ NELLEFRNLE LEERERRSPP
610 620 630 640 650
FNLQIHPFSD GVSALQIYCM KEGVKDVNIP DLIKQLDILG DNGNLRNEEQ
660 670 680 690 700
VAIIQASTVL SLAEKWIQQI EGAEAALHQK MMELESDMEQ FCKIKGYLEE
710 720 730 740 750
ELDYRKQALD QAYMRIQELE ATLYNALQQE TVIKFGELLS EKQQEELRTA
760 770 780 790 800
VEKLRRQMLR KSREYDCQIL QERMELLQQA HQRIRDLEDK TDIQKRQIKD
810
LEEKSNRKHG
Length:810
Mass (Da):94,934
Last modified:December 1, 2001 - v1
Checksum:iD81480AD76DA6A10
GO
Isoform 2 (identifier: Q96AA8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     539-559: Missing.
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:799
Mass (Da):93,620
Checksum:i40CD6861B348F2C4
GO
Isoform 3 (identifier: Q96AA8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:820
Mass (Da):96,258
Checksum:i7C1D5257F1E325AE
GO
Isoform 4 (identifier: Q96AA8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSK → M
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Note: No experimental confirmation available.
Show »
Length:778
Mass (Da):91,546
Checksum:i452F8ED6B1F72BA4
GO

Sequence cautioni

The sequence BAA25481 differs from that shown. Reason: Frameshift at position 805.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_022059106V → I. Corresponds to variant dbSNP:rs3749736Ensembl.1
Natural variantiVAR_035930315R → C in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs761359853Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0552641 – 43MSKKG…QEKSK → M in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_002430539 – 559Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_028230805 – 810SNRKHG → FLFLFLFFSLAFILWP in isoform 2, isoform 3 and isoform 4. 3 Publications6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291280 mRNA. Translation: BAF83969.1.
AK299724 mRNA. Translation: BAG61622.1.
EF512550 mRNA. Translation: ABP62932.1.
AF273057 mRNA. Translation: AAM44460.1.
AB011127 mRNA. Translation: BAA25481.2. Frameshift.
AC011370 Genomic DNA. No translation available.
AC011415 Genomic DNA. No translation available.
AC126775 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61820.1.
CH471062 Genomic DNA. Translation: EAW61821.1.
BC017354 mRNA. Translation: AAH17354.1.
CCDSiCCDS4285.1. [Q96AA8-1]
CCDS59495.1. [Q96AA8-2]
CCDS64284.1. [Q96AA8-4]
CCDS75352.1. [Q96AA8-3]
PIRiT00331.
RefSeqiNP_001257863.1. NM_001270934.1. [Q96AA8-2]
NP_001257870.1. NM_001270941.1. [Q96AA8-3]
NP_001269211.1. NM_001282282.1. [Q96AA8-4]
NP_055605.2. NM_014790.4. [Q96AA8-1]
XP_016865586.1. XM_017010097.1. [Q96AA8-3]
UniGeneiHs.740461.
Hs.744926.

Genome annotation databases

EnsembliENST00000265272; ENSP00000265272; ENSG00000176049. [Q96AA8-1]
ENST00000333010; ENSP00000328989; ENSG00000176049. [Q96AA8-4]
ENST00000507386; ENSP00000421398; ENSG00000176049. [Q96AA8-2]
ENST00000616793; ENSP00000479248; ENSG00000176049. [Q96AA8-3]
GeneIDi9832.
KEGGihsa:9832.
UCSCiuc003loq.3. human. [Q96AA8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiJKIP2_HUMAN
AccessioniPrimary (citable) accession number: Q96AA8
Secondary accession number(s): A4ZZA7
, A8K5G5, B4DSG0, G5E9Y0, O60302, Q548S1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: May 10, 2017
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families