Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 230

Gene

TMEM230

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 230
Gene namesi
Name:TMEM230
Synonyms:C20orf30
ORF Names:HSPC274, UNQ2432/PRO4992
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:15876. TMEM230.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei46 – 6621HelicalSequence analysisAdd
BLAST
Transmembranei79 – 9921HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25746.

Polymorphism and mutation databases

BioMutaiTMEM230.
DMDMi74751737.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 120120Transmembrane protein 230PRO_0000233892Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei23 – 231PhosphoserineCombined sources
Modified residuei24 – 241PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96A57.
MaxQBiQ96A57.
PaxDbiQ96A57.
PRIDEiQ96A57.
TopDownProteomicsiQ96A57-1. [Q96A57-1]
Q96A57-2. [Q96A57-2]

PTM databases

iPTMnetiQ96A57.
PhosphoSiteiQ96A57.

Expressioni

Gene expression databases

BgeeiQ96A57.
CleanExiHS_C20orf30.
ExpressionAtlasiQ96A57. baseline and differential.
GenevisibleiQ96A57. HS.

Organism-specific databases

HPAiHPA009078.

Interactioni

Protein-protein interaction databases

BioGridi118834. 6 interactions.
IntActiQ96A57. 8 interactions.
MINTiMINT-1372090.
STRINGi9606.ENSP00000341364.

Structurei

3D structure databases

ProteinModelPortaliQ96A57.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM134/TMEM230 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4753. Eukaryota.
ENOG4111TWA. LUCA.
GeneTreeiENSGT00390000008694.
HOVERGENiHBG054972.
InParanoidiQ96A57.
OMAiQCVMMPS.
OrthoDBiEOG7NCV5N.
PhylomeDBiQ96A57.
TreeFamiTF329240.

Family and domain databases

InterProiIPR008590. DUF872_TM.
[Graphical view]
PfamiPF05915. DUF872. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q96A57-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMPSRTNLAT GIPSSKVKYS RLSSTDDGYI DLQFKKTPPK IPYKAIALAT
60 70 80 90 100
VLFLIGAFLI IIGSLLLSGY ISKGGADRAV PVLIIGILVF LPGFYHLRIA
110 120
YYASKGYRGY SYDDIPDFDD
Length:120
Mass (Da):13,188
Last modified:December 1, 2001 - v1
Checksum:i18A4A556330D77CE
GO
Isoform 1 (identifier: Q96A57-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQPWALPTVGELWVCGRPGAALRWSLVLSPRLEPSGVISAHCNLHLLASSDSSASASRLCQRVM

Show »
Length:183
Mass (Da):19,910
Checksum:iDBE684AF9FEFBDEB
GO

Sequence cautioni

Isoform 1 : The sequence AAF28952.1 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti59 – 613LII → SY in AAF28952 (Ref. 1) Curated
Sequence conflicti109 – 1091G → A in AAH11990 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQPWALPTVGELWVCGRPGA ALRWSLVLSPRLEPSGVISA HCNLHLLASSDSSASASRLC QRVM in isoform 1. 1 PublicationVSP_018155

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF161392 mRNA. Translation: AAF28952.1. Frameshift.
AY359115 mRNA. Translation: AAQ89473.1.
AK315606 mRNA. Translation: BAG37975.1.
AL121890, AL121924 Genomic DNA. Translation: CAI19213.1.
AL121890, AL121924 Genomic DNA. Translation: CAI19216.1.
AL121924, AL121890 Genomic DNA. Translation: CAI22630.1.
AL121924, AL121890 Genomic DNA. Translation: CAI22627.1.
CH471133 Genomic DNA. Translation: EAX10431.1.
CH471133 Genomic DNA. Translation: EAX10432.1.
CH471133 Genomic DNA. Translation: EAX10433.1.
CH471133 Genomic DNA. Translation: EAX10434.1.
CH471133 Genomic DNA. Translation: EAX10437.1.
BC070212 mRNA. Translation: AAH70212.1.
BC009768 mRNA. Translation: AAH09768.1.
BC009769 mRNA. Translation: AAH09769.1.
BC009770 mRNA. Translation: AAH09770.1.
BC011990 mRNA. Translation: AAH11990.1.
BC015113 mRNA. Translation: AAH15113.1.
BC110408 mRNA. Translation: AAI10409.2.
CCDSiCCDS13086.1. [Q96A57-1]
CCDS33438.1. [Q96A57-2]
RefSeqiNP_001009923.1. NM_001009923.1. [Q96A57-2]
NP_001009924.1. NM_001009924.1. [Q96A57-1]
NP_001009925.1. NM_001009925.1. [Q96A57-1]
NP_054864.3. NM_014145.4. [Q96A57-1]
XP_005260770.1. XM_005260713.2. [Q96A57-1]
XP_006723624.1. XM_006723561.2. [Q96A57-1]
XP_011527529.1. XM_011529227.1. [Q96A57-1]
XP_011527530.1. XM_011529228.1. [Q96A57-1]
XP_011527531.1. XM_011529229.1. [Q96A57-1]
UniGeneiHs.472024.

Genome annotation databases

EnsembliENST00000202834; ENSP00000202834; ENSG00000089063. [Q96A57-1]
ENST00000342308; ENSP00000341364; ENSG00000089063. [Q96A57-2]
ENST00000379277; ENSP00000368579; ENSG00000089063. [Q96A57-1]
ENST00000379279; ENSP00000368581; ENSG00000089063. [Q96A57-1]
ENST00000379283; ENSP00000368585; ENSG00000089063. [Q96A57-1]
ENST00000379286; ENSP00000368588; ENSG00000089063. [Q96A57-1]
ENST00000379299; ENSP00000368601; ENSG00000089063. [Q96A57-1]
GeneIDi29058.
KEGGihsa:29058.
UCSCiuc002wlk.4. human. [Q96A57-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF161392 mRNA. Translation: AAF28952.1. Frameshift.
AY359115 mRNA. Translation: AAQ89473.1.
AK315606 mRNA. Translation: BAG37975.1.
AL121890, AL121924 Genomic DNA. Translation: CAI19213.1.
AL121890, AL121924 Genomic DNA. Translation: CAI19216.1.
AL121924, AL121890 Genomic DNA. Translation: CAI22630.1.
AL121924, AL121890 Genomic DNA. Translation: CAI22627.1.
CH471133 Genomic DNA. Translation: EAX10431.1.
CH471133 Genomic DNA. Translation: EAX10432.1.
CH471133 Genomic DNA. Translation: EAX10433.1.
CH471133 Genomic DNA. Translation: EAX10434.1.
CH471133 Genomic DNA. Translation: EAX10437.1.
BC070212 mRNA. Translation: AAH70212.1.
BC009768 mRNA. Translation: AAH09768.1.
BC009769 mRNA. Translation: AAH09769.1.
BC009770 mRNA. Translation: AAH09770.1.
BC011990 mRNA. Translation: AAH11990.1.
BC015113 mRNA. Translation: AAH15113.1.
BC110408 mRNA. Translation: AAI10409.2.
CCDSiCCDS13086.1. [Q96A57-1]
CCDS33438.1. [Q96A57-2]
RefSeqiNP_001009923.1. NM_001009923.1. [Q96A57-2]
NP_001009924.1. NM_001009924.1. [Q96A57-1]
NP_001009925.1. NM_001009925.1. [Q96A57-1]
NP_054864.3. NM_014145.4. [Q96A57-1]
XP_005260770.1. XM_005260713.2. [Q96A57-1]
XP_006723624.1. XM_006723561.2. [Q96A57-1]
XP_011527529.1. XM_011529227.1. [Q96A57-1]
XP_011527530.1. XM_011529228.1. [Q96A57-1]
XP_011527531.1. XM_011529229.1. [Q96A57-1]
UniGeneiHs.472024.

3D structure databases

ProteinModelPortaliQ96A57.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118834. 6 interactions.
IntActiQ96A57. 8 interactions.
MINTiMINT-1372090.
STRINGi9606.ENSP00000341364.

PTM databases

iPTMnetiQ96A57.
PhosphoSiteiQ96A57.

Polymorphism and mutation databases

BioMutaiTMEM230.
DMDMi74751737.

Proteomic databases

EPDiQ96A57.
MaxQBiQ96A57.
PaxDbiQ96A57.
PRIDEiQ96A57.
TopDownProteomicsiQ96A57-1. [Q96A57-1]
Q96A57-2. [Q96A57-2]

Protocols and materials databases

DNASUi29058.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000202834; ENSP00000202834; ENSG00000089063. [Q96A57-1]
ENST00000342308; ENSP00000341364; ENSG00000089063. [Q96A57-2]
ENST00000379277; ENSP00000368579; ENSG00000089063. [Q96A57-1]
ENST00000379279; ENSP00000368581; ENSG00000089063. [Q96A57-1]
ENST00000379283; ENSP00000368585; ENSG00000089063. [Q96A57-1]
ENST00000379286; ENSP00000368588; ENSG00000089063. [Q96A57-1]
ENST00000379299; ENSP00000368601; ENSG00000089063. [Q96A57-1]
GeneIDi29058.
KEGGihsa:29058.
UCSCiuc002wlk.4. human. [Q96A57-1]

Organism-specific databases

CTDi29058.
GeneCardsiTMEM230.
H-InvDBHIX0015617.
HGNCiHGNC:15876. TMEM230.
HPAiHPA009078.
neXtProtiNX_Q96A57.
PharmGKBiPA25746.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4753. Eukaryota.
ENOG4111TWA. LUCA.
GeneTreeiENSGT00390000008694.
HOVERGENiHBG054972.
InParanoidiQ96A57.
OMAiQCVMMPS.
OrthoDBiEOG7NCV5N.
PhylomeDBiQ96A57.
TreeFamiTF329240.

Miscellaneous databases

ChiTaRSiTMEM230. human.
GenomeRNAii29058.
NextBioi51982.
PROiQ96A57.

Gene expression databases

BgeeiQ96A57.
CleanExiHS_C20orf30.
ExpressionAtlasiQ96A57. baseline and differential.
GenevisibleiQ96A57. HS.

Family and domain databases

InterProiIPR008590. DUF872_TM.
[Graphical view]
PfamiPF05915. DUF872. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Human partial CDS from CD34+ stem cells."
    Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Umbilical cord blood.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Skeletal muscle.
  4. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Bone marrow, Brain, Duodenum, Gall bladder, Lung, Ovary and Prostate.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiTM230_HUMAN
AccessioniPrimary (citable) accession number: Q96A57
Secondary accession number(s): B2RDM8
, D3DVZ9, Q0VGC8, Q5TDS5, Q96ES2, Q9P0A7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: December 1, 2001
Last modified: April 13, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.