Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96A25

- T106A_HUMAN

UniProt

Q96A25 - T106A_HUMAN

Protein

Transmembrane protein 106A

Gene

TMEM106A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transmembrane protein 106A
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:28288. TMEM106A.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670755.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 262262Transmembrane protein 106APRO_0000242137Add
    BLAST

    Proteomic databases

    MaxQBiQ96A25.
    PaxDbiQ96A25.
    PRIDEiQ96A25.

    PTM databases

    PhosphoSiteiQ96A25.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96A25.
    BgeeiQ96A25.
    CleanExiHS_TMEM106A.
    GenevestigatoriQ96A25.

    Interactioni

    Protein-protein interaction databases

    BioGridi125240. 1 interaction.
    IntActiQ96A25. 1 interaction.
    STRINGi9606.ENSP00000330774.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96A25.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei95 – 11521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the TMEM106 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG44552.
    HOGENOMiHOG000230966.
    HOVERGENiHBG055025.
    InParanoidiQ96A25.
    OMAiHTKLFVF.
    PhylomeDBiQ96A25.

    Family and domain databases

    InterProiIPR009790. DUF1356_TMEM106.
    [Graphical view]
    PfamiPF07092. DUF1356. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96A25-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGKTFSQLGS WREDENKSIL SSKPAIGSKA VNYSSTGSSK SFCSCVPCEG    50
    TADASFVTCP TCQGSGKIPQ ELEKQLVALI PYGDQRLKPK HTKLFVFLAV 100
    LICLVTSSFI VFFLFPRSVI VQPAGLNSST VAFDEADIYL NITNILNISN 150
    GNYYPIMVTQ LTLEVLHLSL VVGQVSNNLL LHIGPLASEQ MFYAVATKIR 200
    DENTYKICTW LEIKVHHVLL HIQGTLTCSY LSHSEQLVFQ SYEYVDCRGN 250
    ASVPHQLTPH PP 262
    Length:262
    Mass (Da):28,920
    Last modified:December 1, 2001 - v1
    Checksum:i306433230D5E8D8B
    GO
    Isoform 2 (identifier: Q96A25-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCE → M

    Note: No experimental confirmation available.

    Show »
    Length:214
    Mass (Da):23,849
    Checksum:i6333D07E13D8D9B0
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4949MGKTF…CVPCE → M in isoform 2. 1 PublicationVSP_056642Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056132 mRNA. Translation: BAB71101.1.
    AK290387 mRNA. Translation: BAF83076.1.
    AK299974 mRNA. Translation: BAH13184.1.
    BC012139 mRNA. Translation: AAH12139.1.
    BC146974 mRNA. Translation: AAI46975.1.
    BC146976 mRNA. Translation: AAI46977.1.
    BC147023 mRNA. Translation: AAI47024.1.
    AC087365 Genomic DNA. No translation available.
    AC109326 Genomic DNA. No translation available.
    CH471152 Genomic DNA. Translation: EAW60954.1.
    BC157892 mRNA. Translation: AAI57893.1.
    CCDSiCCDS11462.1.
    RefSeqiNP_001278515.1. NM_001291586.1.
    NP_001278516.1. NM_001291587.1.
    NP_659478.1. NM_145041.3.
    XP_006721721.1. XM_006721658.1.
    UniGeneiHs.536474.

    Genome annotation databases

    EnsembliENST00000541594; ENSP00000439844; ENSG00000184988.
    ENST00000588659; ENSP00000466820; ENSG00000184988.
    GeneIDi113277.
    KEGGihsa:113277.
    UCSCiuc002idn.1. human.

    Polymorphism databases

    DMDMi74731081.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056132 mRNA. Translation: BAB71101.1 .
    AK290387 mRNA. Translation: BAF83076.1 .
    AK299974 mRNA. Translation: BAH13184.1 .
    BC012139 mRNA. Translation: AAH12139.1 .
    BC146974 mRNA. Translation: AAI46975.1 .
    BC146976 mRNA. Translation: AAI46977.1 .
    BC147023 mRNA. Translation: AAI47024.1 .
    AC087365 Genomic DNA. No translation available.
    AC109326 Genomic DNA. No translation available.
    CH471152 Genomic DNA. Translation: EAW60954.1 .
    BC157892 mRNA. Translation: AAI57893.1 .
    CCDSi CCDS11462.1.
    RefSeqi NP_001278515.1. NM_001291586.1.
    NP_001278516.1. NM_001291587.1.
    NP_659478.1. NM_145041.3.
    XP_006721721.1. XM_006721658.1.
    UniGenei Hs.536474.

    3D structure databases

    ProteinModelPortali Q96A25.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 125240. 1 interaction.
    IntActi Q96A25. 1 interaction.
    STRINGi 9606.ENSP00000330774.

    PTM databases

    PhosphoSitei Q96A25.

    Polymorphism databases

    DMDMi 74731081.

    Proteomic databases

    MaxQBi Q96A25.
    PaxDbi Q96A25.
    PRIDEi Q96A25.

    Protocols and materials databases

    DNASUi 113277.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000541594 ; ENSP00000439844 ; ENSG00000184988 .
    ENST00000588659 ; ENSP00000466820 ; ENSG00000184988 .
    GeneIDi 113277.
    KEGGi hsa:113277.
    UCSCi uc002idn.1. human.

    Organism-specific databases

    CTDi 113277.
    GeneCardsi GC17P041363.
    HGNCi HGNC:28288. TMEM106A.
    neXtProti NX_Q96A25.
    PharmGKBi PA142670755.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG44552.
    HOGENOMi HOG000230966.
    HOVERGENi HBG055025.
    InParanoidi Q96A25.
    OMAi HTKLFVF.
    PhylomeDBi Q96A25.

    Miscellaneous databases

    GeneWikii TMEM106A.
    GenomeRNAii 113277.
    NextBioi 78820.
    PROi Q96A25.

    Gene expression databases

    ArrayExpressi Q96A25.
    Bgeei Q96A25.
    CleanExi HS_TMEM106A.
    Genevestigatori Q96A25.

    Family and domain databases

    InterProi IPR009790. DUF1356_TMEM106.
    [Graphical view ]
    Pfami PF07092. DUF1356. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Umbilical cord blood.
    2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney and Testis.

    Entry informationi

    Entry nameiT106A_HUMAN
    AccessioniPrimary (citable) accession number: Q96A25
    Secondary accession number(s): A8K2X2, B7Z698
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 91 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3