Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96A25

- T106A_HUMAN

UniProt

Q96A25 - T106A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transmembrane protein 106A

Gene

TMEM106A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 106A
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:28288. TMEM106A.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670755.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 262262Transmembrane protein 106APRO_0000242137Add
BLAST

Proteomic databases

MaxQBiQ96A25.
PaxDbiQ96A25.
PRIDEiQ96A25.

PTM databases

PhosphoSiteiQ96A25.

Expressioni

Gene expression databases

BgeeiQ96A25.
CleanExiHS_TMEM106A.
ExpressionAtlasiQ96A25. baseline and differential.
GenevestigatoriQ96A25.

Interactioni

Protein-protein interaction databases

BioGridi125240. 1 interaction.
IntActiQ96A25. 1 interaction.
STRINGi9606.ENSP00000330774.

Structurei

3D structure databases

ProteinModelPortaliQ96A25.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei95 – 11521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM106 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG44552.
GeneTreeiENSGT00390000013076.
HOGENOMiHOG000230966.
HOVERGENiHBG055025.
InParanoidiQ96A25.
OMAiHTKLFVF.
PhylomeDBiQ96A25.

Family and domain databases

InterProiIPR009790. DUF1356_TMEM106.
[Graphical view]
PfamiPF07092. DUF1356. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96A25-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKTFSQLGS WREDENKSIL SSKPAIGSKA VNYSSTGSSK SFCSCVPCEG
60 70 80 90 100
TADASFVTCP TCQGSGKIPQ ELEKQLVALI PYGDQRLKPK HTKLFVFLAV
110 120 130 140 150
LICLVTSSFI VFFLFPRSVI VQPAGLNSST VAFDEADIYL NITNILNISN
160 170 180 190 200
GNYYPIMVTQ LTLEVLHLSL VVGQVSNNLL LHIGPLASEQ MFYAVATKIR
210 220 230 240 250
DENTYKICTW LEIKVHHVLL HIQGTLTCSY LSHSEQLVFQ SYEYVDCRGN
260
ASVPHQLTPH PP
Length:262
Mass (Da):28,920
Last modified:December 1, 2001 - v1
Checksum:i306433230D5E8D8B
GO
Isoform 2 (identifier: Q96A25-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCE → M

Note: No experimental confirmation available.

Show »
Length:214
Mass (Da):23,849
Checksum:i6333D07E13D8D9B0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4949MGKTF…CVPCE → M in isoform 2. 1 PublicationVSP_056642Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056132 mRNA. Translation: BAB71101.1.
AK290387 mRNA. Translation: BAF83076.1.
AK299974 mRNA. Translation: BAH13184.1.
BC012139 mRNA. Translation: AAH12139.1.
BC146974 mRNA. Translation: AAI46975.1.
BC146976 mRNA. Translation: AAI46977.1.
BC147023 mRNA. Translation: AAI47024.1.
AC087365 Genomic DNA. No translation available.
AC109326 Genomic DNA. No translation available.
CH471152 Genomic DNA. Translation: EAW60954.1.
BC157892 mRNA. Translation: AAI57893.1.
CCDSiCCDS11462.1. [Q96A25-1]
RefSeqiNP_001278515.1. NM_001291586.1.
NP_001278516.1. NM_001291587.1.
NP_659478.1. NM_145041.3.
XP_005257060.1. XM_005257003.2.
XP_006721721.1. XM_006721658.1.
XP_006721722.1. XM_006721659.1.
UniGeneiHs.536474.

Genome annotation databases

EnsembliENST00000541594; ENSP00000439844; ENSG00000184988. [Q96A25-2]
ENST00000588659; ENSP00000466820; ENSG00000184988. [Q96A25-1]
ENST00000612339; ENSP00000483246; ENSG00000184988. [Q96A25-1]
GeneIDi113277.
KEGGihsa:113277.
UCSCiuc002idn.1. human. [Q96A25-1]

Polymorphism databases

DMDMi74731081.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056132 mRNA. Translation: BAB71101.1 .
AK290387 mRNA. Translation: BAF83076.1 .
AK299974 mRNA. Translation: BAH13184.1 .
BC012139 mRNA. Translation: AAH12139.1 .
BC146974 mRNA. Translation: AAI46975.1 .
BC146976 mRNA. Translation: AAI46977.1 .
BC147023 mRNA. Translation: AAI47024.1 .
AC087365 Genomic DNA. No translation available.
AC109326 Genomic DNA. No translation available.
CH471152 Genomic DNA. Translation: EAW60954.1 .
BC157892 mRNA. Translation: AAI57893.1 .
CCDSi CCDS11462.1. [Q96A25-1 ]
RefSeqi NP_001278515.1. NM_001291586.1.
NP_001278516.1. NM_001291587.1.
NP_659478.1. NM_145041.3.
XP_005257060.1. XM_005257003.2.
XP_006721721.1. XM_006721658.1.
XP_006721722.1. XM_006721659.1.
UniGenei Hs.536474.

3D structure databases

ProteinModelPortali Q96A25.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 125240. 1 interaction.
IntActi Q96A25. 1 interaction.
STRINGi 9606.ENSP00000330774.

PTM databases

PhosphoSitei Q96A25.

Polymorphism databases

DMDMi 74731081.

Proteomic databases

MaxQBi Q96A25.
PaxDbi Q96A25.
PRIDEi Q96A25.

Protocols and materials databases

DNASUi 113277.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000541594 ; ENSP00000439844 ; ENSG00000184988 . [Q96A25-2 ]
ENST00000588659 ; ENSP00000466820 ; ENSG00000184988 . [Q96A25-1 ]
ENST00000612339 ; ENSP00000483246 ; ENSG00000184988 . [Q96A25-1 ]
GeneIDi 113277.
KEGGi hsa:113277.
UCSCi uc002idn.1. human. [Q96A25-1 ]

Organism-specific databases

CTDi 113277.
GeneCardsi GC17P041363.
HGNCi HGNC:28288. TMEM106A.
neXtProti NX_Q96A25.
PharmGKBi PA142670755.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44552.
GeneTreei ENSGT00390000013076.
HOGENOMi HOG000230966.
HOVERGENi HBG055025.
InParanoidi Q96A25.
OMAi HTKLFVF.
PhylomeDBi Q96A25.

Miscellaneous databases

GeneWikii TMEM106A.
GenomeRNAii 113277.
NextBioi 35479912.
PROi Q96A25.

Gene expression databases

Bgeei Q96A25.
CleanExi HS_TMEM106A.
ExpressionAtlasi Q96A25. baseline and differential.
Genevestigatori Q96A25.

Family and domain databases

InterProi IPR009790. DUF1356_TMEM106.
[Graphical view ]
Pfami PF07092. DUF1356. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Umbilical cord blood.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney and Testis.

Entry informationi

Entry nameiT106A_HUMAN
AccessioniPrimary (citable) accession number: Q96A25
Secondary accession number(s): A8K2X2, B7Z698
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3