Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 106A

Gene

TMEM106A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-31828-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 106A
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:28288. TMEM106A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei95 – 115HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi113277.
OpenTargetsiENSG00000184988.
PharmGKBiPA142670755.

Polymorphism and mutation databases

BioMutaiTMEM106A.
DMDMi74731081.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002421371 – 262Transmembrane protein 106AAdd BLAST262

Proteomic databases

MaxQBiQ96A25.
PaxDbiQ96A25.
PeptideAtlasiQ96A25.
PRIDEiQ96A25.

PTM databases

iPTMnetiQ96A25.
PhosphoSitePlusiQ96A25.

Expressioni

Gene expression databases

BgeeiENSG00000184988.
CleanExiHS_TMEM106A.
ExpressionAtlasiQ96A25. baseline and differential.
GenevisibleiQ96A25. HS.

Interactioni

Protein-protein interaction databases

BioGridi125240. 2 interactors.
IntActiQ96A25. 1 interactor.
STRINGi9606.ENSP00000330774.

Structurei

3D structure databases

ProteinModelPortaliQ96A25.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM106 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJ5J. Eukaryota.
ENOG410XUHT. LUCA.
GeneTreeiENSGT00390000013076.
HOGENOMiHOG000230966.
HOVERGENiHBG055025.
InParanoidiQ96A25.
OMAiQMFYAVA.
OrthoDBiEOG091G0KDT.
PhylomeDBiQ96A25.

Family and domain databases

InterProiIPR009790. DUF1356_TMEM106.
[Graphical view]
PfamiPF07092. DUF1356. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96A25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKTFSQLGS WREDENKSIL SSKPAIGSKA VNYSSTGSSK SFCSCVPCEG
60 70 80 90 100
TADASFVTCP TCQGSGKIPQ ELEKQLVALI PYGDQRLKPK HTKLFVFLAV
110 120 130 140 150
LICLVTSSFI VFFLFPRSVI VQPAGLNSST VAFDEADIYL NITNILNISN
160 170 180 190 200
GNYYPIMVTQ LTLEVLHLSL VVGQVSNNLL LHIGPLASEQ MFYAVATKIR
210 220 230 240 250
DENTYKICTW LEIKVHHVLL HIQGTLTCSY LSHSEQLVFQ SYEYVDCRGN
260
ASVPHQLTPH PP
Length:262
Mass (Da):28,920
Last modified:December 1, 2001 - v1
Checksum:i306433230D5E8D8B
GO
Isoform 2 (identifier: Q96A25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCE → M

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):23,849
Checksum:i6333D07E13D8D9B0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566421 – 49MGKTF…CVPCE → M in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056132 mRNA. Translation: BAB71101.1.
AK290387 mRNA. Translation: BAF83076.1.
AK299974 mRNA. Translation: BAH13184.1.
BC012139 mRNA. Translation: AAH12139.1.
BC146974 mRNA. Translation: AAI46975.1.
BC146976 mRNA. Translation: AAI46977.1.
BC147023 mRNA. Translation: AAI47024.1.
AC087365 Genomic DNA. No translation available.
AC109326 Genomic DNA. No translation available.
CH471152 Genomic DNA. Translation: EAW60954.1.
BC157892 mRNA. Translation: AAI57893.1.
CCDSiCCDS11462.1. [Q96A25-1]
CCDS74073.1. [Q96A25-2]
RefSeqiNP_001278515.1. NM_001291586.1. [Q96A25-1]
NP_001278516.1. NM_001291587.1. [Q96A25-2]
NP_659478.1. NM_145041.3. [Q96A25-1]
XP_006721721.1. XM_006721658.2. [Q96A25-1]
XP_006721722.1. XM_006721659.3. [Q96A25-2]
XP_016879603.1. XM_017024114.1. [Q96A25-2]
UniGeneiHs.536474.

Genome annotation databases

EnsembliENST00000541594; ENSP00000439844; ENSG00000184988. [Q96A25-2]
ENST00000588659; ENSP00000466820; ENSG00000184988. [Q96A25-1]
ENST00000612339; ENSP00000483246; ENSG00000184988. [Q96A25-1]
GeneIDi113277.
KEGGihsa:113277.
UCSCiuc002idn.2. human. [Q96A25-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056132 mRNA. Translation: BAB71101.1.
AK290387 mRNA. Translation: BAF83076.1.
AK299974 mRNA. Translation: BAH13184.1.
BC012139 mRNA. Translation: AAH12139.1.
BC146974 mRNA. Translation: AAI46975.1.
BC146976 mRNA. Translation: AAI46977.1.
BC147023 mRNA. Translation: AAI47024.1.
AC087365 Genomic DNA. No translation available.
AC109326 Genomic DNA. No translation available.
CH471152 Genomic DNA. Translation: EAW60954.1.
BC157892 mRNA. Translation: AAI57893.1.
CCDSiCCDS11462.1. [Q96A25-1]
CCDS74073.1. [Q96A25-2]
RefSeqiNP_001278515.1. NM_001291586.1. [Q96A25-1]
NP_001278516.1. NM_001291587.1. [Q96A25-2]
NP_659478.1. NM_145041.3. [Q96A25-1]
XP_006721721.1. XM_006721658.2. [Q96A25-1]
XP_006721722.1. XM_006721659.3. [Q96A25-2]
XP_016879603.1. XM_017024114.1. [Q96A25-2]
UniGeneiHs.536474.

3D structure databases

ProteinModelPortaliQ96A25.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125240. 2 interactors.
IntActiQ96A25. 1 interactor.
STRINGi9606.ENSP00000330774.

PTM databases

iPTMnetiQ96A25.
PhosphoSitePlusiQ96A25.

Polymorphism and mutation databases

BioMutaiTMEM106A.
DMDMi74731081.

Proteomic databases

MaxQBiQ96A25.
PaxDbiQ96A25.
PeptideAtlasiQ96A25.
PRIDEiQ96A25.

Protocols and materials databases

DNASUi113277.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000541594; ENSP00000439844; ENSG00000184988. [Q96A25-2]
ENST00000588659; ENSP00000466820; ENSG00000184988. [Q96A25-1]
ENST00000612339; ENSP00000483246; ENSG00000184988. [Q96A25-1]
GeneIDi113277.
KEGGihsa:113277.
UCSCiuc002idn.2. human. [Q96A25-1]

Organism-specific databases

CTDi113277.
DisGeNETi113277.
GeneCardsiTMEM106A.
HGNCiHGNC:28288. TMEM106A.
neXtProtiNX_Q96A25.
OpenTargetsiENSG00000184988.
PharmGKBiPA142670755.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ5J. Eukaryota.
ENOG410XUHT. LUCA.
GeneTreeiENSGT00390000013076.
HOGENOMiHOG000230966.
HOVERGENiHBG055025.
InParanoidiQ96A25.
OMAiQMFYAVA.
OrthoDBiEOG091G0KDT.
PhylomeDBiQ96A25.

Enzyme and pathway databases

BioCyciZFISH:G66-31828-MONOMER.

Miscellaneous databases

GeneWikiiTMEM106A.
GenomeRNAii113277.
PROiQ96A25.

Gene expression databases

BgeeiENSG00000184988.
CleanExiHS_TMEM106A.
ExpressionAtlasiQ96A25. baseline and differential.
GenevisibleiQ96A25. HS.

Family and domain databases

InterProiIPR009790. DUF1356_TMEM106.
[Graphical view]
PfamiPF07092. DUF1356. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiT106A_HUMAN
AccessioniPrimary (citable) accession number: Q96A25
Secondary accession number(s): A8K2X2, B7Z698
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.