Q969W9 (PMEPA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane prostate androgen-induced protein Alternative name(s): Solid tumor-associated 1 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 287 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in down-regulation of the androgen receptor (AR). Enhances ubiquitination and proteasome-mediated degradation of AR, probably by recruiting NEDD4. Ref.8 |
| Subunit structure | Interacts with NEDD4 (via WW domains). Interacts with AR. Ref.7 Ref.8 |
| Subcellular location | Cell membrane; Single-pass membrane protein Potential. |
| Tissue specificity | Highest expression in prostate. Also expressed in ovary. |
| Induction | By androgen. |
| Domain | The WW-binding motifs mediate interaction with NEDD4 By similarity. |
| Sequence similarities | Belongs to the PMEPA1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | androgen receptor signaling pathway Non-traceable author statement Ref.1. Source: UniProtKB negative regulation of transforming growth factor beta receptor signaling pathwayTraceable author statement. Source: Reactome transforming growth factor beta receptor signaling pathwayTraceable author statement. Source: Reactome |
| Cellular_component | early endosome membrane Traceable author statement. Source: Reactome integral to membraneNon-traceable author statement Ref.1. Source: UniProtKB plasma membraneTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q969W9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q969W9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEIT → MA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q969W9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 287 | 287 | Transmembrane prostate androgen-induced protein | PRO_0000185442 | |||||
Regions | |||||||||
| Topological domain | 1 – 40 | 40 | Extracellular Potential | ||||||
| Transmembrane | 41 – 63 | 23 | Helical; Potential | ||||||
| Topological domain | 64 – 287 | 224 | Cytoplasmic Potential | ||||||
| Motif | 158 – 161 | 4 | WW-binding 1 | ||||||
| Motif | 229 – 232 | 4 | WW-binding 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 50 | 50 | Missing in isoform 3. | VSP_044588 | |||||
| Alternative sequence | 1 – 37 | 37 | MHRLM…SMEIT → MA in isoform 2. | VSP_006438 | |||||
| Natural variant | 128 | 1 | E → D. Corresponds to variant rs41314918 [ dbSNP | Ensembl ]. | VAR_062154 | |||||
Experimental info | |||||||||
| Mutagenesis | 161 | 1 | Y → A: Impairs interaction with NEDD4. Impairs polyubiquitination of AR; when associated with A-232. Ref.7 Ref.8 | ||||||
| Mutagenesis | 232 | 1 | Y → A: Impairs interaction with NEDD4. Impairs polyubiquitination of AR; when associated with A-232. Ref.7 Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel androgen-regulated gene, PMEPA1, located on chromosome 20q13 exhibits high level expression in prostate." Xu L.L., Shanmugam N., Segawa T., Sesterhenn I.A., McLeod D.G., Moul J.W., Srivastava S. Genomics 66:257-263(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Characterization of a novel gene, STAG1/PMEPA1, upregulated in renal cell carcinoma and other solid tumors." Rae F.K., Hooper J.D., Nicol D.L., Clements J.A. Mol. Carcinog. 32:44-53(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "PMEPA1, a transforming growth factor-beta-induced marker of terminal colonocyte differentiation whose expression is maintained in primary and metastatic colon cancer." Brunschwig E.B., Wilson K., Mack D., Dawson D., Lawrence E., Willson J.K.V., Lu S., Nosrati A., Rerko R.M., Swinler S., Beard L., Lutterbaugh J.D., Willis J., Platzer P., Markowitz S. Cancer Res. 63:1568-1575(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-287 (ISOFORM 1). Tissue: Kidney. |
| [7] | "PMEPA1, an androgen-regulated NEDD4-binding protein, exhibits cell growth inhibitory function and decreased expression during prostate cancer progression." Xu L.L., Shi Y., Petrovics G., Sun C., Makarem M., Zhang W., Sesterhenn I.A., McLeod D.G., Sun L., Moul J.W., Srivastava S. Cancer Res. 63:4299-4304(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4, MUTAGENESIS OF TYR-161 AND TYR-232. |
| [8] | "A feedback loop between the androgen receptor and a NEDD4-binding protein, PMEPA1, in prostate cancer cells." Li H., Xu L.L., Masuda K., Raymundo E., McLeod D.G., Dobi A., Srivastava S. J. Biol. Chem. 283:28988-28995(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH AR, MUTAGENESIS OF TYR-161 AND TYR-232. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF224278 mRNA. Translation: AAF86322.1. AF305616 mRNA. Translation: AAL16781.1. AY128643 mRNA. Translation: AAM89277.1. AF305426 Genomic DNA. Translation: AAL09357.1. AL035541, AL121913 Genomic DNA. Translation: CAI23105.1. AL121913, AL035541 Genomic DNA. Translation: CAI19031.1. AL121913, AL035541 Genomic DNA. Translation: CAM27272.1. AL035541, AL121913 Genomic DNA. Translation: CAM28295.1. CH471077 Genomic DNA. Translation: EAW75505.1. CH471077 Genomic DNA. Translation: EAW75508.1. BC015918 mRNA. Translation: AAH15918.2. |
| IPI | IPI00056521. IPI00183679. IPI00396293. |
| RefSeq | NP_001242905.1. NM_001255976.1. NP_064567.2. NM_020182.4. NP_954638.1. NM_199169.2. NP_954639.1. NM_199170.2. NP_954640.1. NM_199171.2. |
| UniGene | Hs.517155. |
3D structure databases | |
| ProteinModelPortal | Q969W9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q969W9. 1 interaction. |
| STRING | 9606.ENSP00000345826. |
PTM databases | |
| PhosphoSite | Q969W9. |
Polymorphism databases | |
| DMDM | 20140695. |
Proteomic databases | |
| PaxDb | Q969W9. |
| PRIDE | Q969W9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265626; ENSP00000265626; ENSG00000124225. ENST00000341744; ENSP00000345826; ENSG00000124225. ENST00000347215; ENSP00000344014; ENSG00000124225. ENST00000395814; ENSP00000379159; ENSG00000124225. ENST00000395816; ENSP00000379161; ENSG00000124225. |
| GeneID | 56937. |
| KEGG | hsa:56937. |
| UCSC | uc002xyq.3. human. |
Organism-specific databases | |
| CTD | 56937. |
| GeneCards | GC20M056223. |
| HGNC | HGNC:14107. PMEPA1. |
| MIM | 606564. gene. |
| neXtProt | NX_Q969W9. |
| PharmGKB | PA162399822. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG27420. |
| HOGENOM | HOG000276535. |
| HOVERGEN | HBG059833. |
| OMA | HIAPLES. |
| OrthoDB | EOG49GKHD. |
| PhylomeDB | Q969W9. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q969W9. |
| Bgee | Q969W9. |
| CleanEx | HS_PMEPA1. HS_STAG1. |
| Genevestigator | Q969W9. |
| GermOnline | ENSG00000124225. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 56937. |
| NextBio | 62491. |
| SOURCE | Search... |
Entry information
| Entry name | PMEPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q969W9 Secondary accession number(s): Q5TDR6 Q9UJD3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
