SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q969M7

- UBE2F_HUMAN

UniProt

Q969M7 - UBE2F_HUMAN

Protein

NEDD8-conjugating enzyme UBE2F

Gene

UBE2F

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.1 Publication

    Catalytic activityi

    ATP + NEDD8 + protein lysine = AMP + diphosphate + protein N-NEDD8yllysine.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei116 – 1161Glycyl thioester intermediatePROSITE-ProRule annotations

    GO - Molecular functioni

    1. acid-amino acid ligase activity Source: InterPro
    2. ATP binding Source: UniProtKB-KW
    3. NEDD8 ligase activity Source: UniProtKB
    4. protein binding Source: UniProtKB

    GO - Biological processi

    1. protein neddylation Source: UniProtKB

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinkiC9J212.
    Q969M7.
    UniPathwayiUPA00885.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NEDD8-conjugating enzyme UBE2F (EC:6.3.2.-)
    Alternative name(s):
    NEDD8 carrier protein UBE2F
    NEDD8 protein ligase UBE2F
    NEDD8-conjugating enzyme 2
    Ubiquitin-conjugating enzyme E2 F
    Gene namesi
    Name:UBE2F
    Synonyms:NCE2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

    Organism-specific databases

    HGNCiHGNC:12480. UBE2F.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37130.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 185185NEDD8-conjugating enzyme UBE2FPRO_0000263077Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication

    Post-translational modificationi

    The acetylation of Met-1 increases affinity for DCUN1D3 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ969M7.
    PaxDbiQ969M7.
    PeptideAtlasiQ969M7.
    PRIDEiQ969M7.

    PTM databases

    PhosphoSiteiQ969M7.

    Expressioni

    Tissue specificityi

    Widely expressed (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ969M7.
    BgeeiQ969M7.
    CleanExiHS_UBE2F.
    GenevestigatoriQ969M7.

    Organism-specific databases

    HPAiHPA037444.

    Interactioni

    Subunit structurei

    Interacts with UBA3 and RBX2.2 Publications

    Protein-protein interaction databases

    BioGridi126682. 11 interactions.
    IntActiQ969M7. 6 interactions.
    STRINGi9606.ENSP00000272930.

    Structurei

    Secondary structure

    1
    185
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi4 – 85
    Helixi32 – 4413
    Helixi45 – 473
    Beta strandi52 – 554
    Beta strandi57 – 604
    Beta strandi64 – 696
    Beta strandi72 – 743
    Turni75 – 784
    Beta strandi81 – 866
    Beta strandi97 – 1004
    Beta strandi107 – 1093
    Beta strandi111 – 1133
    Helixi118 – 1203
    Beta strandi124 – 1263
    Helixi136 – 14510
    Turni146 – 1505
    Beta strandi153 – 1553
    Helixi159 – 1679
    Helixi169 – 18315

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EDINMR-A26-185[»]
    3FN1X-ray2.50B21-185[»]
    4GBAX-ray2.40F/G1-25[»]
    ProteinModelPortaliQ969M7.
    SMRiQ969M7. Positions 26-185.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ969M7.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 2929Interaction with UBA3Add
    BLAST

    Sequence similaritiesi

    Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.PROSITE-ProRule annotations

    Phylogenomic databases

    eggNOGiCOG5078.
    HOGENOMiHOG000233456.
    HOVERGENiHBG098591.
    InParanoidiQ969M7.
    KOiK10687.
    OMAiWHPNISE.
    PhylomeDBiQ969M7.
    TreeFamiTF101125.

    Family and domain databases

    Gene3Di3.10.110.10. 1 hit.
    InterProiIPR000608. UBQ-conjugat_E2.
    IPR023313. UBQ-conjugating_AS.
    IPR016135. UBQ-conjugating_enzyme/RWD.
    [Graphical view]
    PfamiPF00179. UQ_con. 1 hit.
    [Graphical view]
    SUPFAMiSSF54495. SSF54495. 1 hit.
    PROSITEiPS00183. UBIQUITIN_CONJUGAT_1. 1 hit.
    PS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q969M7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLTLASKLKR DDGLKGSRTA ATASDSTRRV SVRDKLLVKE VAELEANLPC    50
    TCKVHFPDPN KLHCFQLTVT PDEGYYQGGK FQFETEVPDA YNMVPPKVKC 100
    LTKIWHPNIT ETGEICLSLL REHSIDGTGW APTRTLKDVV WGLNSLFTDL 150
    LNFDDPLNIE AAEHHLRDKE DFRNKVDDYI KRYAR 185
    Length:185
    Mass (Da):21,077
    Last modified:December 1, 2001 - v1
    Checksum:iB22C86238D13216E
    GO
    Isoform 2 (identifier: Q969M7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         170-185: EDFRNKVDDYIKRYAR → SPMLLLHRRTSGIKWMTTSNVMPDNKRGRLQAHGLCYSLSLT

    Note: No experimental confirmation available.

    Show »
    Length:211
    Mass (Da):23,760
    Checksum:i26D6D083CACA07ED
    GO
    Isoform 3 (identifier: Q969M7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-71: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:153
    Mass (Da):17,500
    Checksum:i738B62CEF923150C
    GO
    Isoform 4 (identifier: Q969M7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         118-120: SLL → RIF
         121-185: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:120
    Mass (Da):13,513
    Checksum:iB7A58924FDDB46AF
    GO
    Isoform 5 (identifier: Q969M7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         72-185: DEGYYQGGKF...VDDYIKRYAR → ASQSEMPDQDLAPQHHRDRGNMSEFIERTFN

    Note: No experimental confirmation available.

    Show »
    Length:102
    Mass (Da):11,450
    Checksum:i676F8ABBE02435AE
    GO
    Isoform 6 (identifier: Q969M7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         149-169: Missing.

    Note: Gene prediction based on EST data.

    Show »
    Length:164
    Mass (Da):18,619
    Checksum:iF8EDC983E452DE4D
    GO
    Isoform 7 (identifier: Q969M7-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVK → MVLGAGPASPVSGSP

    Note: Gene prediction based on EST data.

    Show »
    Length:161
    Mass (Da):18,158
    Checksum:i44700812DFACB9CE
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3939MLTLA…KLLVK → MVLGAGPASPVSGSP in isoform 7. CuratedVSP_055749Add
    BLAST
    Alternative sequencei40 – 7132Missing in isoform 3. 1 PublicationVSP_037270Add
    BLAST
    Alternative sequencei72 – 185114DEGYY…KRYAR → ASQSEMPDQDLAPQHHRDRG NMSEFIERTFN in isoform 5. 1 PublicationVSP_037271Add
    BLAST
    Alternative sequencei118 – 1203SLL → RIF in isoform 4. 1 PublicationVSP_037272
    Alternative sequencei121 – 18565Missing in isoform 4. 1 PublicationVSP_037273Add
    BLAST
    Alternative sequencei149 – 16921Missing in isoform 6. CuratedVSP_055750Add
    BLAST
    Alternative sequencei170 – 18516EDFRN…KRYAR → SPMLLLHRRTSGIKWMTTSN VMPDNKRGRLQAHGLCYSLS LT in isoform 2. 1 PublicationVSP_037274Add
    BLAST

    Sequence conflict

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti181 – 1811K → E in BAF82752. (PubMed:14702039)Curated

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF310723 mRNA. Translation: AAL26792.1.
    AK290063 mRNA. Translation: BAF82752.1.
    AK293334 mRNA. Translation: BAG56850.1.
    AK294107 mRNA. Translation: BAG57442.1.
    AK297502 mRNA. Translation: BAG59915.1.
    AK303094 mRNA. Translation: BAG64204.1.
    AC016776 Genomic DNA. Translation: AAY24220.1.
    CH471063 Genomic DNA. Translation: EAW71129.1.
    CH471063 Genomic DNA. Translation: EAW71132.1.
    BC010549 mRNA. Translation: AAH10549.1.
    CCDSiCCDS2523.1. [Q969M7-1]
    CCDS63177.1. [Q969M7-3]
    RefSeqiNP_001265234.1. NM_001278305.1. [Q969M7-1]
    NP_001265235.1. NM_001278306.1.
    NP_001265236.1. NM_001278307.1. [Q969M7-3]
    NP_001265237.1. NM_001278308.1.
    NP_542409.1. NM_080678.2. [Q969M7-1]
    UniGeneiHs.471785.

    Genome annotation databases

    EnsembliENST00000272930; ENSP00000272930; ENSG00000184182. [Q969M7-1]
    ENST00000409633; ENSP00000387299; ENSG00000184182. [Q969M7-6]
    ENST00000409953; ENSP00000386680; ENSG00000184182. [Q969M7-7]
    ENST00000414443; ENSP00000399183; ENSG00000184182. [Q969M7-3]
    ENST00000433241; ENSP00000393515; ENSG00000184182. [Q969M7-4]
    ENST00000441728; ENSP00000409749; ENSG00000184182. [Q969M7-5]
    GeneIDi140739.
    KEGGihsa:140739.
    UCSCiuc002vxk.3. human. [Q969M7-1]
    uc010znn.2. human. [Q969M7-3]
    uc010znp.2. human. [Q969M7-4]

    Polymorphism databases

    DMDMi74751725.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF310723 mRNA. Translation: AAL26792.1 .
    AK290063 mRNA. Translation: BAF82752.1 .
    AK293334 mRNA. Translation: BAG56850.1 .
    AK294107 mRNA. Translation: BAG57442.1 .
    AK297502 mRNA. Translation: BAG59915.1 .
    AK303094 mRNA. Translation: BAG64204.1 .
    AC016776 Genomic DNA. Translation: AAY24220.1 .
    CH471063 Genomic DNA. Translation: EAW71129.1 .
    CH471063 Genomic DNA. Translation: EAW71132.1 .
    BC010549 mRNA. Translation: AAH10549.1 .
    CCDSi CCDS2523.1. [Q969M7-1 ]
    CCDS63177.1. [Q969M7-3 ]
    RefSeqi NP_001265234.1. NM_001278305.1. [Q969M7-1 ]
    NP_001265235.1. NM_001278306.1.
    NP_001265236.1. NM_001278307.1. [Q969M7-3 ]
    NP_001265237.1. NM_001278308.1.
    NP_542409.1. NM_080678.2. [Q969M7-1 ]
    UniGenei Hs.471785.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EDI NMR - A 26-185 [» ]
    3FN1 X-ray 2.50 B 21-185 [» ]
    4GBA X-ray 2.40 F/G 1-25 [» ]
    ProteinModelPortali Q969M7.
    SMRi Q969M7. Positions 26-185.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126682. 11 interactions.
    IntActi Q969M7. 6 interactions.
    STRINGi 9606.ENSP00000272930.

    PTM databases

    PhosphoSitei Q969M7.

    Polymorphism databases

    DMDMi 74751725.

    Proteomic databases

    MaxQBi Q969M7.
    PaxDbi Q969M7.
    PeptideAtlasi Q969M7.
    PRIDEi Q969M7.

    Protocols and materials databases

    DNASUi 140739.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000272930 ; ENSP00000272930 ; ENSG00000184182 . [Q969M7-1 ]
    ENST00000409633 ; ENSP00000387299 ; ENSG00000184182 . [Q969M7-6 ]
    ENST00000409953 ; ENSP00000386680 ; ENSG00000184182 . [Q969M7-7 ]
    ENST00000414443 ; ENSP00000399183 ; ENSG00000184182 . [Q969M7-3 ]
    ENST00000433241 ; ENSP00000393515 ; ENSG00000184182 . [Q969M7-4 ]
    ENST00000441728 ; ENSP00000409749 ; ENSG00000184182 . [Q969M7-5 ]
    GeneIDi 140739.
    KEGGi hsa:140739.
    UCSCi uc002vxk.3. human. [Q969M7-1 ]
    uc010znn.2. human. [Q969M7-3 ]
    uc010znp.2. human. [Q969M7-4 ]

    Organism-specific databases

    CTDi 140739.
    GeneCardsi GC02P238875.
    HGNCi HGNC:12480. UBE2F.
    HPAi HPA037444.
    neXtProti NX_Q969M7.
    PharmGKBi PA37130.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5078.
    HOGENOMi HOG000233456.
    HOVERGENi HBG098591.
    InParanoidi Q969M7.
    KOi K10687.
    OMAi WHPNISE.
    PhylomeDBi Q969M7.
    TreeFami TF101125.

    Enzyme and pathway databases

    UniPathwayi UPA00885 .
    Reactomei REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinki C9J212.
    Q969M7.

    Miscellaneous databases

    EvolutionaryTracei Q969M7.
    GenomeRNAii 140739.
    NextBioi 84333.
    PROi Q969M7.

    Gene expression databases

    ArrayExpressi Q969M7.
    Bgeei Q969M7.
    CleanExi HS_UBE2F.
    Genevestigatori Q969M7.

    Family and domain databases

    Gene3Di 3.10.110.10. 1 hit.
    InterProi IPR000608. UBQ-conjugat_E2.
    IPR023313. UBQ-conjugating_AS.
    IPR016135. UBQ-conjugating_enzyme/RWD.
    [Graphical view ]
    Pfami PF00179. UQ_con. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54495. SSF54495. 1 hit.
    PROSITEi PS00183. UBIQUITIN_CONJUGAT_1. 1 hit.
    PS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NEDD8-conjugating enzyme."
      Gladysheva T., Chau V.
      Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
      Tissue: Brain, Brain cortex, Glial tumor, Substantia nigra and Thymus.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    6. "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification."
      Huang D.T., Ayrault O., Hunt H.W., Taherbhoy A.M., Duda D.M., Scott D.C., Borg L.A., Neale G., Murray P.J., Roussel M.F., Schulman B.A.
      Mol. Cell 33:483-495(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-185 IN COMPLEX WITH UBA3, FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH UBA3; NAE1 AND RBX2.
    7. "Solution structure of the UQ_CON domain from human NEDD8-conjugating enzyme NCE2."
      RIKEN structural genomics initiative (RSGI)
      Submitted (AUG-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 23-185.
    8. "Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes."
      Monda J.K., Scott D.C., Miller D.J., Lydeard J., King D., Harper J.W., Bennett E.J., Schulman B.A.
      Structure 21:42-53(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 1-25 IN COMPLEX WITH DCUN1D3, ACETYLATION AT MET-1.

    Entry informationi

    Entry nameiUBE2F_HUMAN
    AccessioniPrimary (citable) accession number: Q969M7
    Secondary accession number(s): A8K1Z8
    , B4DDT9, B4DFI1, B4DMK3, B4DZU2, B8ZZG2, C9J212, H9KVB9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 12, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi