Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NEDD8-conjugating enzyme UBE2F

Gene

UBE2F

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.1 Publication

Catalytic activityi

S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N6-[NEDD8-protein]-yl-[cullin]-L-lysine.1 Publication

Pathwayi: protein neddylation

This protein is involved in the pathway protein neddylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein neddylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei116Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • post-translational protein modification Source: Reactome
  • protein neddylation Source: UniProtKB

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ969M7
UniPathwayiUPA00885

Names & Taxonomyi

Protein namesi
Recommended name:
NEDD8-conjugating enzyme UBE2F (EC:2.3.2.321 Publication)
Alternative name(s):
NEDD8 carrier protein UBE2F
NEDD8 protein ligase UBE2F
NEDD8-conjugating enzyme 2
RING-type E3 NEDD8 transferase UBE2F
Ubiquitin-conjugating enzyme E2 F
Gene namesi
Name:UBE2F
Synonyms:NCE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000184182.18
HGNCiHGNC:12480 UBE2F
MIMi617700 gene
neXtProtiNX_Q969M7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi140739
OpenTargetsiENSG00000184182
PharmGKBiPA37130

Polymorphism and mutation databases

BioMutaiUBE2F
DMDMi74751725

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002630771 – 185NEDD8-conjugating enzyme UBE2FAdd BLAST185

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionine1 Publication1

Post-translational modificationi

The acetylation of Met-1 increases affinity for DCUN1D3 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ969M7
PaxDbiQ969M7
PeptideAtlasiQ969M7
PRIDEiQ969M7

PTM databases

iPTMnetiQ969M7
PhosphoSitePlusiQ969M7

Expressioni

Tissue specificityi

Widely expressed (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000184182
CleanExiHS_UBE2F
ExpressionAtlasiQ969M7 baseline and differential
GenevisibleiQ969M7 HS

Organism-specific databases

HPAiHPA037444

Interactioni

Subunit structurei

Interacts with UBA3 and RBX2.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi126682, 15 interactors
ELMiQ969M7
IntActiQ969M7, 8 interactors
STRINGi9606.ENSP00000272930

Structurei

Secondary structure

1185
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi4 – 8Combined sources5
Helixi32 – 44Combined sources13
Helixi45 – 47Combined sources3
Beta strandi52 – 55Combined sources4
Beta strandi57 – 60Combined sources4
Beta strandi64 – 69Combined sources6
Beta strandi72 – 74Combined sources3
Turni75 – 78Combined sources4
Beta strandi81 – 86Combined sources6
Beta strandi97 – 100Combined sources4
Beta strandi107 – 109Combined sources3
Beta strandi111 – 113Combined sources3
Helixi118 – 120Combined sources3
Beta strandi124 – 126Combined sources3
Helixi136 – 145Combined sources10
Turni146 – 150Combined sources5
Beta strandi153 – 155Combined sources3
Helixi159 – 167Combined sources9
Helixi169 – 183Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EDINMR-A26-185[»]
3FN1X-ray2.50B21-185[»]
4GBAX-ray2.40F/G1-25[»]
ProteinModelPortaliQ969M7
SMRiQ969M7
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ969M7

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 29Interaction with UBA31 PublicationAdd BLAST29

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0420 Eukaryota
ENOG410XS81 LUCA
GeneTreeiENSGT00630000089859
HOGENOMiHOG000233456
HOVERGENiHBG098591
InParanoidiQ969M7
KOiK10687
OMAiWHPNISE
OrthoDBiEOG091G0N8A
PhylomeDBiQ969M7
TreeFamiTF101125

Family and domain databases

CDDicd00195 UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR023313 UBQ-conjugating_AS
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS00183 UBIQUITIN_CONJUGAT_1, 1 hit
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q969M7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLTLASKLKR DDGLKGSRTA ATASDSTRRV SVRDKLLVKE VAELEANLPC
60 70 80 90 100
TCKVHFPDPN KLHCFQLTVT PDEGYYQGGK FQFETEVPDA YNMVPPKVKC
110 120 130 140 150
LTKIWHPNIT ETGEICLSLL REHSIDGTGW APTRTLKDVV WGLNSLFTDL
160 170 180
LNFDDPLNIE AAEHHLRDKE DFRNKVDDYI KRYAR
Length:185
Mass (Da):21,077
Last modified:December 1, 2001 - v1
Checksum:iB22C86238D13216E
GO
Isoform 2 (identifier: Q969M7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-185: EDFRNKVDDYIKRYAR → SPMLLLHRRTSGIKWMTTSNVMPDNKRGRLQAHGLCYSLSLT

Note: No experimental confirmation available.
Show »
Length:211
Mass (Da):23,760
Checksum:i26D6D083CACA07ED
GO
Isoform 3 (identifier: Q969M7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-71: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):17,500
Checksum:i738B62CEF923150C
GO
Isoform 4 (identifier: Q969M7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-120: SLL → RIF
     121-185: Missing.

Note: No experimental confirmation available.
Show »
Length:120
Mass (Da):13,513
Checksum:iB7A58924FDDB46AF
GO
Isoform 5 (identifier: Q969M7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-185: DEGYYQGGKF...VDDYIKRYAR → ASQSEMPDQDLAPQHHRDRGNMSEFIERTFN

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,450
Checksum:i676F8ABBE02435AE
GO
Isoform 6 (identifier: Q969M7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-169: Missing.

Note: Gene prediction based on EST data.
Show »
Length:164
Mass (Da):18,619
Checksum:iF8EDC983E452DE4D
GO
Isoform 7 (identifier: Q969M7-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVK → MVLGAGPASPVSGSP

Note: Gene prediction based on EST data.
Show »
Length:161
Mass (Da):18,158
Checksum:i44700812DFACB9CE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti181K → E in BAF82752 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0557491 – 39MLTLA…KLLVK → MVLGAGPASPVSGSP in isoform 7. CuratedAdd BLAST39
Alternative sequenceiVSP_03727040 – 71Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_03727172 – 185DEGYY…KRYAR → ASQSEMPDQDLAPQHHRDRG NMSEFIERTFN in isoform 5. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_037272118 – 120SLL → RIF in isoform 4. 1 Publication3
Alternative sequenceiVSP_037273121 – 185Missing in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_055750149 – 169Missing in isoform 6. CuratedAdd BLAST21
Alternative sequenceiVSP_037274170 – 185EDFRN…KRYAR → SPMLLLHRRTSGIKWMTTSN VMPDNKRGRLQAHGLCYSLS LT in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF310723 mRNA Translation: AAL26792.1
AK290063 mRNA Translation: BAF82752.1
AK293334 mRNA Translation: BAG56850.1
AK294107 mRNA Translation: BAG57442.1
AK297502 mRNA Translation: BAG59915.1
AK303094 mRNA Translation: BAG64204.1
AC016776 Genomic DNA Translation: AAY24220.1
CH471063 Genomic DNA Translation: EAW71129.1
CH471063 Genomic DNA Translation: EAW71132.1
BC010549 mRNA Translation: AAH10549.1
CCDSiCCDS2523.1 [Q969M7-1]
CCDS63175.1 [Q969M7-7]
CCDS63176.1 [Q969M7-6]
CCDS63177.1 [Q969M7-3]
RefSeqiNP_001265234.1, NM_001278305.1 [Q969M7-1]
NP_001265235.1, NM_001278306.1 [Q969M7-7]
NP_001265236.1, NM_001278307.1 [Q969M7-3]
NP_001265237.1, NM_001278308.1 [Q969M7-6]
NP_542409.1, NM_080678.2 [Q969M7-1]
UniGeneiHs.471785

Genome annotation databases

EnsembliENST00000272930; ENSP00000272930; ENSG00000184182 [Q969M7-1]
ENST00000409633; ENSP00000387299; ENSG00000184182 [Q969M7-6]
ENST00000409953; ENSP00000386680; ENSG00000184182 [Q969M7-7]
ENST00000414443; ENSP00000399183; ENSG00000184182 [Q969M7-3]
ENST00000433241; ENSP00000393515; ENSG00000184182 [Q969M7-4]
ENST00000441728; ENSP00000409749; ENSG00000184182 [Q969M7-5]
ENST00000612130; ENSP00000478474; ENSG00000184182 [Q969M7-1]
GeneIDi140739
KEGGihsa:140739
UCSCiuc002vxk.4 human [Q969M7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiUBE2F_HUMAN
AccessioniPrimary (citable) accession number: Q969M7
Secondary accession number(s): A8K1Z8
, B4DDT9, B4DFI1, B4DMK3, B4DZU2, B8ZZG2, C9J212, H9KVB9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 1, 2001
Last modified: May 23, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health