Q969M7 (UBE2F_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NEDD8-conjugating enzyme UBE2F EC=6.3.2.- Alternative name(s): NEDD8 carrier protein UBE2F NEDD8 protein ligase UBE2F NEDD8-conjugating enzyme 2 Ubiquitin-conjugating enzyme E2 F | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 185 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5. Ref.7 |
| Catalytic activity | ATP + NEDD8 + protein lysine = AMP + diphosphate + protein N-NEDD8yllysine. |
| Pathway | |
| Subunit structure | Interacts with UBA3 and RBX2. Ref.7 |
| Tissue specificity | Widely expressed (at protein level). Ref.7 |
| Sequence similarities | Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Ligase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein neddylation Inferred from direct assay Ref.7. Source: UniProtKB |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW NEDD8 ligase activityInferred from direct assay Ref.7. Source: UniProtKB protein bindingInferred from physical interaction Ref.7. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q969M7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q969M7-2) The sequence of this isoform differs from the canonical sequence as follows: 170-185: EDFRNKVDDYIKRYAR → SPMLLLHRRTSGIKWMTTSNVMPDNKRGRLQAHGLCYSLSLT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q969M7-3) The sequence of this isoform differs from the canonical sequence as follows: 40-71: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q969M7-4) The sequence of this isoform differs from the canonical sequence as follows: 118-120: SLL → RIF 121-185: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q969M7-5) The sequence of this isoform differs from the canonical sequence as follows: 72-185: DEGYYQGGKF...VDDYIKRYAR → ASQSEMPDQDLAPQHHRDRGNMSEFIERTFN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 185 | 185 | NEDD8-conjugating enzyme UBE2F | PRO_0000263077 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Region | 1 – 29 | 29 | Interaction with UBA3 | |||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||
| Active site | 116 | 1 | Glycyl thioester intermediate By similarity | |||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.6 | |||||||||||||||||||||||||||||
| Modified residue | 7 | 1 | N6-acetyllysine Ref.6 | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 40 – 71 | 32 | Missing in isoform 3. | VSP_037270 | ||||||||||||||||||||||||||||
| Alternative sequence | 72 – 185 | 114 | DEGYY…KRYAR → ASQSEMPDQDLAPQHHRDRG NMSEFIERTFN in isoform 5. | VSP_037271 | ||||||||||||||||||||||||||||
| Alternative sequence | 118 – 120 | 3 | SLL → RIF in isoform 4. | VSP_037272 | ||||||||||||||||||||||||||||
| Alternative sequence | 121 – 185 | 65 | Missing in isoform 4. | VSP_037273 | ||||||||||||||||||||||||||||
| Alternative sequence | 170 – 185 | 16 | EDFRN…KRYAR → SPMLLLHRRTSGIKWMTTSN VMPDNKRGRLQAHGLCYSLS LT in isoform 2. | VSP_037274 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Sequence conflict | 181 | 1 | K → E in BAF82752. Ref.2 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Helix | 32 – 47 | 16 | ||||||||||||||||||||||||||||||
| Beta strand | 50 – 55 | 6 | ||||||||||||||||||||||||||||||
| Beta strand | 63 – 69 | 7 | ||||||||||||||||||||||||||||||
| Beta strand | 72 – 75 | 4 | ||||||||||||||||||||||||||||||
| Beta strand | 81 – 86 | 6 | ||||||||||||||||||||||||||||||
| Beta strand | 97 – 100 | 4 | ||||||||||||||||||||||||||||||
| Beta strand | 107 – 109 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 111 – 113 | 3 | ||||||||||||||||||||||||||||||
| Helix | 136 – 145 | 10 | ||||||||||||||||||||||||||||||
| Turn | 146 – 148 | 3 | ||||||||||||||||||||||||||||||
| Helix | 159 – 167 | 9 | ||||||||||||||||||||||||||||||
| Helix | 169 – 183 | 15 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NEDD8-conjugating enzyme." Gladysheva T., Chau V. Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5). Tissue: Brain, Brain cortex, Glial tumor, Substantia nigra and Thymus. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1 AND LYS-7, MASS SPECTROMETRY. |
| [7] | "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification." Huang D.T., Ayrault O., Hunt H.W., Taherbhoy A.M., Duda D.M., Scott D.C., Borg L.A., Neale G., Murray P.J., Roussel M.F., Schulman B.A. Mol. Cell 33:483-495(2009) [PubMed: 19250909] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-185 IN COMPLEX WITH UBA3, FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH UBA3; NAE1 AND RBX2. |
| [8] | "Solution structure of the UQ_CON domain from human NEDD8-conjugating enzyme NCE2." RIKEN structural genomics initiative (RSGI) Submitted (AUG-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 23-185. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF310723 mRNA. Translation: AAL26792.1. AK290063 mRNA. Translation: BAF82752.1. AK293334 mRNA. Translation: BAG56850.1. AK294107 mRNA. Translation: BAG57442.1. AK297502 mRNA. Translation: BAG59915.1. AK303094 mRNA. Translation: BAG64204.1. AC016776 Genomic DNA. Translation: AAY24220.1. CH471063 Genomic DNA. Translation: EAW71129.1. CH471063 Genomic DNA. Translation: EAW71132.1. BC010549 mRNA. Translation: AAH10549.1. | ||||||||||||||||||
| IPI | IPI00056432. IPI00908717. IPI00909362. IPI00910610. IPI00917266. | ||||||||||||||||||
| RefSeq | NP_542409.1. NM_080678.2. | ||||||||||||||||||
| UniGene | Hs.471785. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q969M7. | ||||||||||||||||||
| SMR | Q969M7. Positions 26-185. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q969M7. 6 interactions. | ||||||||||||||||||
| STRING | Q969M7. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q969M7. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 74751725. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PeptideAtlas | Q969M7. | ||||||||||||||||||
| PRIDE | Q969M7. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000272930; ENSP00000272930; ENSG00000184182. | ||||||||||||||||||
| GeneID | 140739. | ||||||||||||||||||
| KEGG | hsa:140739. | ||||||||||||||||||
| UCSC | uc002vxk.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 140739. | ||||||||||||||||||
| GeneCards | GC02P238875. | ||||||||||||||||||
| H-InvDB | HIX0002961. | ||||||||||||||||||
| HGNC | HGNC:12480. UBE2F. | ||||||||||||||||||
| HPA | HPA037444. | ||||||||||||||||||
| neXtProt | NX_Q969M7. | ||||||||||||||||||
| PharmGKB | PA37130. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG15381. | ||||||||||||||||||
| GeneTree | ENSGT00390000012900. | ||||||||||||||||||
| HOVERGEN | HBG098591. | ||||||||||||||||||
| InParanoid | Q969M7. | ||||||||||||||||||
| OMA | WHPNISE. | ||||||||||||||||||
| OrthoDB | EOG4J1195. | ||||||||||||||||||
| PhylomeDB | Q969M7. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q969M7. | ||||||||||||||||||
| Bgee | Q969M7. | ||||||||||||||||||
| CleanEx | HS_UBE2F. | ||||||||||||||||||
| Genevestigator | Q969M7. | ||||||||||||||||||
| GermOnline | ENSG00000184182. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000608. UBQ-conjugat_E2. IPR023313. UBQ-conjugating_AS. IPR016135. UBQ-conjugating_enzyme/RWD. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:3.10.110.10. UBQ-conjugat_E2. 1 hit. | ||||||||||||||||||
| KO | K10687. | ||||||||||||||||||
| Pfam | PF00179. UQ_con. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF54495. UBQ-conjugat/RWD-like. 1 hit. | ||||||||||||||||||
| PROSITE | PS00183. UBIQUITIN_CONJUGAT_1. 1 hit. PS50127. UBIQUITIN_CONJUGAT_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 84333. | ||||||||||||||||||
Entry information
| Entry name | UBE2F_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q969M7 Secondary accession number(s): A8K1Z8 B8ZZG2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with