SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q969K4

- ABTB1_HUMAN

UniProt

Q969K4 - ABTB1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ankyrin repeat and BTB/POZ domain-containing protein 1
Gene
ABTB1, BPOZ, PP2259
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

May act as a mediator of the PTEN growth-suppressive signaling pathway. May play a role in developmental processes.2 Publications

GO - Molecular functioni

  1. translation elongation factor activity Source: UniProtKB-KW
Complete GO annotation...

GO - Biological processi

    Complete GO annotation...

    Keywords - Molecular functioni

    Elongation factor

    Keywords - Biological processi

    Protein biosynthesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ankyrin repeat and BTB/POZ domain-containing protein 1
    Alternative name(s):
    Elongation factor 1A-binding protein
    Gene namesi
    Name:ABTB1
    Synonyms:BPOZ
    ORF Names:PP2259
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:18275. ABTB1.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleolus Source: HPA
    3. plasma membrane Source: HPA
    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24418.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 478478Ankyrin repeat and BTB/POZ domain-containing protein 1
    PRO_0000248267Add
    BLAST

    Proteomic databases

    PaxDbiQ969K4.
    PRIDEiQ969K4.

    PTM databases

    PhosphoSiteiQ969K4.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed in all fetal tissues examined including heart, brain, liver, and kidney. Also expressed at lower levels in both adult heart and hypertrophic heart.1 Publication

    Gene expression databases

    ArrayExpressiQ969K4.
    BgeeiQ969K4.
    CleanExiHS_ABTB1.
    GenevestigatoriQ969K4.

    Organism-specific databases

    HPAiHPA035022.
    HPA035023.

    Interactioni

    Protein-protein interaction databases

    BioGridi123237. 4 interactions.
    IntActiQ969K4. 2 interactions.
    MINTiMINT-1193021.
    STRINGi9606.ENSP00000232744.

    Structurei

    3D structure databases

    ProteinModelPortaliQ969K4.
    SMRiQ969K4. Positions 6-91, 106-182, 241-404.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati1 – 3131ANK 1
    Add
    BLAST
    Repeati35 – 6430ANK 2
    Add
    BLAST
    Domaini115 – 18268BTB 1
    Add
    BLAST
    Domaini272 – 34675BTB 2
    Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili451 – 47727 Reviewed prediction
    Add
    BLAST

    Sequence similaritiesi

    Contains 2 ANK repeats.
    Contains 2 BTB (POZ) domains.

    Keywords - Domaini

    ANK repeat, Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOGENOMiHOG000253956.
    HOVERGENiHBG059559.
    InParanoidiQ969K4.
    KOiK10520.
    OMAiDIRYYLS.
    PhylomeDBiQ969K4.
    TreeFamiTF329194.

    Family and domain databases

    Gene3Di1.25.40.20. 1 hit.
    3.30.710.10. 2 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    [Graphical view]
    PfamiPF00651. BTB. 2 hits.
    [Graphical view]
    SMARTiSM00248. ANK. 2 hits.
    SM00225. BTB. 2 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    SSF54695. SSF54695. 2 hits.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 1 hit.
    PS50097. BTB. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 22 Publications (identifier: Q969K4-1) [UniParc]FASTAAdd to Basket

    Also known as: BPOZ-2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDTSDLFASC RKGDVGRVRY LLEQRDVEVN VRDKWDSTPL YYACLCGHEE    50
    LVLYLLANGA RCEANTFDGE RCLYGALSDP IRRALRDYKQ VTASCRRRDY 100
    YDDFLQRLLE QGIHSDVVFV VHGKPFRVHR CVLGARSAYF ANMLDTKWKG 150
    KSVVVLRHPL INPVAFGALL QYLYTGRLDI GVEHVSDCER LAKQCQLWDL 200
    LSDLEAKCEK VSEFVASKPG TCVKVLTIEP PPADPRLRED MALLADCALP 250
    PELRGDLWEL PFPCPDGFNS CPDICFRVAG CSFLCHKAFF CGRSDYFRAL 300
    LDDHFRESEE PATSGGPPAV TLHGISPDVF THVLYYMYSD HTELSPEAAY 350
    DVLSVADMYL LPGLKRLCGR SLAQMLDEDT VVGVWRVAKL FRLARLEDQC 400
    TEYMAKVIEK LVEREDFVEA VKEEAAAVAA RQETDSIPLV DDIRFHVAST 450
    VQTYSAIEEA QQRLRALEDL LVSIGLDC 478
    Length:478
    Mass (Da):53,979
    Last modified:December 1, 2001 - v1
    Checksum:iBF2B9959A5BF0BB5
    GO
    Isoform 12 Publications (identifier: Q969K4-2) [UniParc]FASTAAdd to Basket

    Also known as: BPOZ-1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-142: Missing.

    Show »
    Length:336
    Mass (Da):37,576
    Checksum:i71B2545E5F3EB18A
    GO
    Isoform 31 Publication (identifier: Q969K4-3) [UniParc]FASTAAdd to Basket

    Also known as: BPOZ-3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-40: MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPL → MWAECGTCWSSETWR

    Show »
    Length:453
    Mass (Da):51,141
    Checksum:i5EE45A2DA214325F
    GO
    Isoform 41 Publication (identifier: Q969K4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-50: Missing.
         87-196: DYKQVTASCR...DCERLAKQCQ → LCGHEE
         255-287: Missing.
         468-478: EDLLVSIGLDC → LETSMCMRLC...SPKSSPLALA

    Note: No experimental confirmation available.

    Show »
    Length:405
    Mass (Da):44,428
    Checksum:iF85371BD5B10F7D8
    GO

    Sequence cautioni

    The sequence AAQ04661.1 differs from that shown. Reason: Frameshift at positions 202 and 212.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 142142Missing in isoform 1. 2 Publications
    VSP_052148Add
    BLAST
    Alternative sequencei1 – 4040MDTSD…DSTPL → MWAECGTCWSSETWR in isoform 3. 1 Publication
    VSP_052149Add
    BLAST
    Alternative sequencei24 – 5027Missing in isoform 4. 1 Publication
    VSP_052150Add
    BLAST
    Alternative sequencei87 – 196110DYKQV…AKQCQ → LCGHEE in isoform 4. 1 Publication
    VSP_052151Add
    BLAST
    Alternative sequencei255 – 28733Missing in isoform 4. 1 Publication
    VSP_052152Add
    BLAST
    Alternative sequencei468 – 47811EDLLVSIGLDC → LETSMCMRLCAALLPAPCTL RASWGVRGAQWGFSSLHEPG DPRGGSIWDEPPPPNAQASP QDPGGGHHSGKPGVGVGFGL STFLLQIPPTHPSPKSSPLA LA in isoform 4. 1 Publication
    VSP_052153Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053324 mRNA. Translation: BAB55648.1.
    AB053325 mRNA. Translation: BAB55649.1.
    AB053326 mRNA. Translation: BAB55650.1.
    AF447886 mRNA. Translation: AAQ04661.1. Frameshift.
    AK130594 mRNA. Translation: BAC85392.1.
    CH471052 Genomic DNA. Translation: EAW79333.1.
    CH471052 Genomic DNA. Translation: EAW79334.1.
    BC011858 mRNA. Translation: AAH11858.1.
    AF297986 mRNA. Translation: AAK57478.1.
    CCDSiCCDS3045.1. [Q969K4-1]
    CCDS46901.1. [Q969K4-2]
    PIRiJC7326.
    RefSeqiNP_115937.1. NM_032548.3. [Q969K4-2]
    NP_742024.1. NM_172027.2. [Q969K4-1]
    XP_006713835.1. XM_006713772.1. [Q969K4-2]
    UniGeneiHs.107812.

    Genome annotation databases

    EnsembliENST00000232744; ENSP00000232744; ENSG00000114626. [Q969K4-1]
    ENST00000393363; ENSP00000377030; ENSG00000114626. [Q969K4-2]
    ENST00000453791; ENSP00000412684; ENSG00000114626. [Q969K4-2]
    ENST00000468137; ENSP00000417366; ENSG00000114626. [Q969K4-2]
    GeneIDi80325.
    KEGGihsa:80325.
    UCSCiuc003ejr.3. human. [Q969K4-1]
    uc003ejs.3. human. [Q969K4-3]

    Polymorphism databases

    DMDMi74751721.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053324 mRNA. Translation: BAB55648.1 .
    AB053325 mRNA. Translation: BAB55649.1 .
    AB053326 mRNA. Translation: BAB55650.1 .
    AF447886 mRNA. Translation: AAQ04661.1 . Frameshift.
    AK130594 mRNA. Translation: BAC85392.1 .
    CH471052 Genomic DNA. Translation: EAW79333.1 .
    CH471052 Genomic DNA. Translation: EAW79334.1 .
    BC011858 mRNA. Translation: AAH11858.1 .
    AF297986 mRNA. Translation: AAK57478.1 .
    CCDSi CCDS3045.1. [Q969K4-1 ]
    CCDS46901.1. [Q969K4-2 ]
    PIRi JC7326.
    RefSeqi NP_115937.1. NM_032548.3. [Q969K4-2 ]
    NP_742024.1. NM_172027.2. [Q969K4-1 ]
    XP_006713835.1. XM_006713772.1. [Q969K4-2 ]
    UniGenei Hs.107812.

    3D structure databases

    ProteinModelPortali Q969K4.
    SMRi Q969K4. Positions 6-91, 106-182, 241-404.
    ModBasei Search...

    Protein-protein interaction databases

    BioGridi 123237. 4 interactions.
    IntActi Q969K4. 2 interactions.
    MINTi MINT-1193021.
    STRINGi 9606.ENSP00000232744.

    PTM databases

    PhosphoSitei Q969K4.

    Polymorphism databases

    DMDMi 74751721.

    Proteomic databases

    PaxDbi Q969K4.
    PRIDEi Q969K4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000232744 ; ENSP00000232744 ; ENSG00000114626 . [Q969K4-1 ]
    ENST00000393363 ; ENSP00000377030 ; ENSG00000114626 . [Q969K4-2 ]
    ENST00000453791 ; ENSP00000412684 ; ENSG00000114626 . [Q969K4-2 ]
    ENST00000468137 ; ENSP00000417366 ; ENSG00000114626 . [Q969K4-2 ]
    GeneIDi 80325.
    KEGGi hsa:80325.
    UCSCi uc003ejr.3. human. [Q969K4-1 ]
    uc003ejs.3. human. [Q969K4-3 ]

    Organism-specific databases

    CTDi 80325.
    GeneCardsi GC03P127391.
    HGNCi HGNC:18275. ABTB1.
    HPAi HPA035022.
    HPA035023.
    MIMi 608308. gene.
    neXtProti NX_Q969K4.
    PharmGKBi PA24418.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOGENOMi HOG000253956.
    HOVERGENi HBG059559.
    InParanoidi Q969K4.
    KOi K10520.
    OMAi DIRYYLS.
    PhylomeDBi Q969K4.
    TreeFami TF329194.

    Miscellaneous databases

    GeneWikii ABTB1.
    GenomeRNAii 80325.
    NextBioi 70855.
    PROi Q969K4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q969K4.
    Bgeei Q969K4.
    CleanExi HS_ABTB1.
    Genevestigatori Q969K4.

    Family and domain databases

    Gene3Di 1.25.40.20. 1 hit.
    3.30.710.10. 2 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    [Graphical view ]
    Pfami PF00651. BTB. 2 hits.
    [Graphical view ]
    SMARTi SM00248. ANK. 2 hits.
    SM00225. BTB. 2 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    SSF54695. SSF54695. 2 hits.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 1 hit.
    PS50097. BTB. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    « Hide 'large scale' publications
    1. "Molecular cloning and characterization of a novel human gene containing ankyrin repeat and double BTB/POZ domain."
      Dai K.-S., Wei W., Liew C.-C.
      Biochem. Biophys. Res. Commun. 273:991-996(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Leukocyte.
    2. "Growth-suppressive effects of BPOZ and EGR2, two genes involved in the PTEN signaling pathway."
      Unoki M., Nakamura Y.
      Oncogene 20:4457-4465(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, SUBCELLULAR LOCATION.
    3. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Spleen.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: B-cell.
    7. "Translation elongation factor 1A binding protein."
      Mansilla F., Clark B.F.C., Knudsen C.R.
      Thesis (2001), University of Aarhus, Denmark
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Skeletal muscle.

    Entry informationi

    Entry nameiABTB1_HUMAN
    AccessioniPrimary (citable) accession number: Q969K4
    Secondary accession number(s): D3DNB0
    , Q6ZNU9, Q71MF1, Q96S62, Q96S63
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 5, 2006
    Last sequence update: December 1, 2001
    Last modified: July 9, 2014
    This is version 102 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi