Q969K4 (ABTB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin repeat and BTB/POZ domain-containing protein 1 Alternative name(s): Elongation factor 1A-binding protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 478 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May act as a mediator of the PTEN growth-suppressive signaling pathway. May play a role in developmental processes. Ref.1 Ref.2 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed in all fetal tissues examined including heart, brain, liver, and kidney. Also expressed at lower levels in both adult heart and hypertrophic heart. Ref.1 |
| Sequence similarities | Contains 2 ANK repeats. Contains 2 BTB (POZ) domains. |
| Sequence caution | The sequence AAQ04661.1 differs from that shown. Reason: Frameshift at positions 202 and 212. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Coiled coil Repeat |
| Molecular function | Elongation factor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleolusInferred from direct assay. Source: HPA plasma membraneInferred from direct assay. Source: HPA |
| Molecular_function | translation elongation factor activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 Ref.1 Ref.2 (identifier: Q969K4-1) Also known as: BPOZ-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 Ref.2 Ref.3 (identifier: Q969K4-2) Also known as: BPOZ-1; The sequence of this isoform differs from the canonical sequence as follows: 1-142: Missing. | ||||||
| Isoform 3 Ref.2 (identifier: Q969K4-3) Also known as: BPOZ-3; The sequence of this isoform differs from the canonical sequence as follows: 1-40: MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPL → MWAECGTCWSSETWR | ||||||
| Isoform 4 Ref.4 (identifier: Q969K4-4) The sequence of this isoform differs from the canonical sequence as follows: 24-50: Missing. 87-196: DYKQVTASCR...DCERLAKQCQ → LCGHEE 255-287: Missing. 468-478: EDLLVSIGLDC → LETSMCMRLC...SPKSSPLALA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 478 | 478 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | PRO_0000248267 | |||||
Regions | |||||||||
| Repeat | 1 – 31 | 31 | ANK 1 | ||||||
| Repeat | 35 – 64 | 30 | ANK 2 | ||||||
| Domain | 115 – 182 | 68 | BTB 1 | ||||||
| Domain | 272 – 346 | 75 | BTB 2 | ||||||
| Coiled coil | 451 – 477 | 27 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 142 | 142 | Missing in isoform 1. Ref.2 Ref.3 | VSP_052148 | |||||
| Alternative sequence | 1 – 40 | 40 | MDTSD…DSTPL → MWAECGTCWSSETWR in isoform 3. Ref.2 | VSP_052149 | |||||
| Alternative sequence | 24 – 50 | 27 | Missing in isoform 4. Ref.4 | VSP_052150 | |||||
| Alternative sequence | 87 – 196 | 110 | DYKQV…AKQCQ → LCGHEE in isoform 4. Ref.4 | VSP_052151 | |||||
| Alternative sequence | 255 – 287 | 33 | Missing in isoform 4. Ref.4 | VSP_052152 | |||||
| Alternative sequence | 468 – 478 | 11 | EDLLVSIGLDC → LETSMCMRLCAALLPAPCTL RASWGVRGAQWGFSSLHEPG DPRGGSIWDEPPPPNAQASP QDPGGGHHSGKPGVGVGFGL STFLLQIPPTHPSPKSSPLA LA in isoform 4. Ref.4 | VSP_052153 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel human gene containing ankyrin repeat and double BTB/POZ domain." Dai K.-S., Wei W., Liew C.-C. Biochem. Biophys. Res. Commun. 273:991-996(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. Tissue: Leukocyte. |
| [2] | "Growth-suppressive effects of BPOZ and EGR2, two genes involved in the PTEN signaling pathway." Unoki M., Nakamura Y. Oncogene 20:4457-4465(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, SUBCELLULAR LOCATION. |
| [3] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Spleen. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: B-cell. |
| [7] | "Translation elongation factor 1A binding protein." Mansilla F., Clark B.F.C., Knudsen C.R. Thesis (2001), University of Aarhus, Denmark Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Skeletal muscle. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB053324 mRNA. Translation: BAB55648.1. AB053325 mRNA. Translation: BAB55649.1. AB053326 mRNA. Translation: BAB55650.1. AF447886 mRNA. Translation: AAQ04661.1. Frameshift. AK130594 mRNA. Translation: BAC85392.1. CH471052 Genomic DNA. Translation: EAW79333.1. CH471052 Genomic DNA. Translation: EAW79334.1. BC011858 mRNA. Translation: AAH11858.1. AF297986 mRNA. Translation: AAK57478.1. |
| IPI | IPI00172592. IPI00172612. IPI00220832. IPI00442508. |
| PIR | JC7326. |
| RefSeq | NP_115937.1. NM_032548.3. NP_742024.1. NM_172027.2. |
| UniGene | Hs.107812. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1R29 based on UniProtKB P41182. |
| ProteinModelPortal | Q969K4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1193021. |
| STRING | 9606.ENSP00000232744. |
PTM databases | |
| PhosphoSite | Q969K4. |
Polymorphism databases | |
| DMDM | 74751721. |
Proteomic databases | |
| PaxDb | Q969K4. |
| PRIDE | Q969K4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000232744; ENSP00000232744; ENSG00000114626. ENST00000393363; ENSP00000377030; ENSG00000114626. ENST00000453791; ENSP00000412684; ENSG00000114626. ENST00000468137; ENSP00000417366; ENSG00000114626. |
| GeneID | 80325. |
| KEGG | hsa:80325. |
| UCSC | uc003ejr.3. human. uc003ejs.3. human. |
Organism-specific databases | |
| CTD | 80325. |
| GeneCards | GC03P127391. |
| HGNC | HGNC:18275. ABTB1. |
| HPA | HPA035022. HPA035023. |
| MIM | 608308. gene. |
| neXtProt | NX_Q969K4. |
| PharmGKB | PA24418. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0666. |
| HOGENOM | HOG000253956. |
| HOVERGEN | HBG059559. |
| InParanoid | Q969K4. |
| KO | K10520. |
| OMA | LEQGIHS. |
| PhylomeDB | Q969K4. |
Gene expression databases | |
| ArrayExpress | Q969K4. |
| Bgee | Q969K4. |
| CleanEx | HS_ABTB1. |
| Genevestigator | Q969K4. |
| GermOnline | ENSG00000114626. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 1 hit. 3.30.710.10. 2 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. [Graphical view] |
| Pfam | PF00651. BTB. 2 hits. [Graphical view] |
| SMART | SM00248. ANK. 2 hits. SM00225. BTB. 2 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. SSF54695. BTB/POZ_fold. 2 hits. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 1 hit. PS50097. BTB. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 80325. |
| NextBio | 70855. |
| SOURCE | Search... |
Entry information
| Entry name | ABTB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q969K4 Secondary accession number(s): D3DNB0 Q96S63 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
