Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q95ZJ1 (GALT5_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Polypeptide N-acetylgalactosaminyltransferase 5

Short name=pp-GaNTase 5
EC=2.4.1.41
Alternative name(s):
Protein-UDP acetylgalactosaminyltransferase 5
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5
Gene names
Name:gly-5
ORF Names:Y39E4B.12
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length626 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Catalytic activity

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.

Cofactor

Manganese By similarity.

Pathway

Protein modification; protein glycosylation.

Subcellular location

Golgi apparatus membrane; Single-pass type II membrane protein By similarity.

Domain

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity.

The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity.

Sequence similarities

Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.

Contains 1 ricin B-type lectin domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q95ZJ1-1)

Also known as: GLY5b; GLY-5b;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b (identifier: Q95ZJ1-2)

Also known as: GLY5a; GLY-5a;

The sequence of this isoform differs from the canonical sequence as follows:
     492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → MRNAGGKNRQCIDYKPSGGKTVGMYQCHN
Isoform c (identifier: Q95ZJ1-3)

Also known as: GLY5c; GLY-5c;

The sequence of this isoform differs from the canonical sequence as follows:
     492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → LRNAQTSQCLDSAVGEEVENKAITPYPCHE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 626626Polypeptide N-acetylgalactosaminyltransferase 5
PRO_0000059148

Regions

Topological domain1 – 1111Cytoplasmic Potential
Transmembrane12 – 3120Helical; Signal-anchor for type II membrane protein; Potential
Topological domain32 – 626595Lumenal Potential
Domain488 – 610123Ricin B-type lectin
Region174 – 284111Catalytic subdomain A
Region345 – 40763Catalytic subdomain B

Sites

Metal binding2681Manganese By similarity
Metal binding2701Manganese By similarity
Metal binding4041Manganese By similarity
Binding site2151Substrate By similarity
Binding site2451Substrate By similarity
Binding site2691Substrate By similarity
Binding site3761Substrate By similarity
Binding site4071Substrate By similarity
Binding site4121Substrate By similarity

Amino acid modifications

Glycosylation321N-linked (GlcNAc...) Potential
Glycosylation3381N-linked (GlcNAc...) Potential
Disulfide bond165 ↔ 399 By similarity
Disulfide bond390 ↔ 466 By similarity
Disulfide bond502 ↔ 521 By similarity
Disulfide bond544 ↔ 557 By similarity
Disulfide bond583 ↔ 598 By similarity

Natural variations

Alternative sequence492 – 52332VRNSA…YQCHG → MRNAGGKNRQCIDYKPSGGK TVGMYQCHN in isoform b.
VSP_011238
Alternative sequence492 – 52332VRNSA…YQCHG → LRNAQTSQCLDSAVGEEVEN KAITPYPCHE in isoform c.
VSP_011239

Experimental info

Sequence conflict3611K → E in AAC13671. Ref.1
Sequence conflict3611K → E in AAC13672. Ref.1
Sequence conflict3611K → E in AAC13673. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform a (GLY5b) (GLY-5b) [UniParc].

Last modified August 16, 2004. Version 2.
Checksum: 561BD0576514B983

FASTA62671,382
        10         20         30         40         50         60 
MIIFKKKAIL KVLLLVPVFW ICSLIFFAAT SNDSSQIGSN NDLANKIAEA NFHPKAAKQD 

        70         80         90        100        110        120 
VIQGFGPPIE PEPVVENNKV EEEEQPGGNL AKPKFMVDPN DPIYKKGDAA QAGELGKAVV 

       130        140        150        160        170        180 
VDKTKLSTEE KAKYDKGMLN NAFNQYASDM ISVHRTLPTN IDAECKTEKY NENLPRTSVI 

       190        200        210        220        230        240 
ICFHNEAWSV LLRTVHSVLE RTPDHLLEEV VLVDDFSDMD HTKRPLEEYM SQFGGKVKIL 

       250        260        270        280        290        300 
RMEKREGLIR ARLRGAAVAT GEVLTYLDSH CECMEGWMEP LLDRIKRDPT TVVCPVIDVI 

       310        320        330        340        350        360 
DDNTFEYHHS KAYFTSVGGF DWGLQFNWHS IPERDRKNRT RPIDPVRSPT MAGGLFSIDK 

       370        380        390        400        410        420 
KYFEKLGTYD PGFDIWGGEN LELSFKIWMC GGTLEIVPCS HVGHVFRKRS PYKWRTGVNV 

       430        440        450        460        470        480 
LKRNSIRLAE VWLDDYKTYY YERINNQLGD FGDISSRKKL REDLGCKSFK WYLDNIYPEL 

       490        500        510        520        530        540 
FVPGESVAKG EVRNSAVQPA RCLDCMVGRH EKNRPVGTYQ CHGQGGNQYW MLSKDGEIRR 

       550        560        570        580        590        600 
DESCVDYAGS DVMVFPCHGM KGNQEWRYNH DTGRLQHAVS QKCLGMTKDG AKLEMVACQY 

       610        620 
DDPYQHWKFK EYNEAKAIEH GAKPPS 

« Hide

Isoform b (GLY5a) (GLY-5a) [UniParc].

Checksum: 722AC7E93EF5FE4D
Show »

FASTA62371,014
Isoform c (GLY5c) (GLY-5c) [UniParc].

Checksum: 4959436CAE9916D4
Show »

FASTA62471,103

References

« Hide 'large scale' references
[1]"cDNA cloning and expression of a family of UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase sequence homologs from Caenorhabditis elegans."
Hagen F.K., Nehrke K.
J. Biol. Chem. 273:8268-8277(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C).
Strain: Bristol N2.
[2]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Bristol N2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF031835 mRNA. Translation: AAC13671.1.
AF031836 mRNA. Translation: AAC13672.1.
AF031837 mRNA. Translation: AAC13673.1.
AL110487 Genomic DNA. Translation: CAB54435.1.
AL110487 Genomic DNA. Translation: CAC42369.1.
AL110487 Genomic DNA. Translation: CAC42368.1.
PIRT42245.
T42246.
T42247.
RefSeqNP_001022850.1. NM_001027679.4. [Q95ZJ1-1]
NP_001022851.1. NM_001027680.4. [Q95ZJ1-2]
NP_001022852.1. NM_001027681.5. [Q95ZJ1-3]
UniGeneCel.19665.

3D structure databases

ProteinModelPortalQ95ZJ1.
SMRQ95ZJ1. Positions 154-607.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid41908. 4 interactions.
DIPDIP-26207N.
IntActQ95ZJ1. 3 interactions.
MINTMINT-1041440.
STRING6239.Y39E4B.12a.1.

Protein family/group databases

CAZyCBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

Proteomic databases

PaxDbQ95ZJ1.
PRIDEQ95ZJ1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaY39E4B.12a.1; Y39E4B.12a.1; WBGene00001630. [Q95ZJ1-1]
Y39E4B.12a.2; Y39E4B.12a.2; WBGene00001630. [Q95ZJ1-1]
GeneID176736.
KEGGcel:CELE_Y39E4B.12.
UCSCY39E4B.12c. c. elegans. [Q95ZJ1-1]

Organism-specific databases

CTD176736.
WormBaseY39E4B.12a; CE24240; WBGene00001630; gly-5.
Y39E4B.12b; CE28119; WBGene00001630; gly-5.
Y39E4B.12c; CE28120; WBGene00001630; gly-5.

Phylogenomic databases

eggNOGNOG239675.
GeneTreeENSGT00750000117385.
HOGENOMHOG000038227.
InParanoidQ95ZJ1.
KOK00710.
OMAYNENLPR.
PhylomeDBQ95ZJ1.

Enzyme and pathway databases

UniPathwayUPA00378.

Family and domain databases

Gene3D3.90.550.10. 1 hit.
InterProIPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view]
PfamPF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view]
SMARTSM00458. RICIN. 1 hit.
[Graphical view]
SUPFAMSSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEPS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio893796.

Entry information

Entry nameGALT5_CAEEL
AccessionPrimary (citable) accession number: Q95ZJ1
Secondary accession number(s): O61391 expand/collapse secondary AC list , O61392, O61393, Q95ZJ2, Q9U2J8
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: July 9, 2014
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase