Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q95ZJ1

- GALT5_CAEEL

UniProt

Q95ZJ1 - GALT5_CAEEL

Protein

Polypeptide N-acetylgalactosaminyltransferase 5

Gene

gly-5

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 2 (16 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

    Catalytic activityi

    UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.

    Cofactori

    Manganese.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei215 – 2151SubstrateBy similarity
    Binding sitei245 – 2451SubstrateBy similarity
    Metal bindingi268 – 2681ManganeseBy similarity
    Binding sitei269 – 2691SubstrateBy similarity
    Metal bindingi270 – 2701ManganeseBy similarity
    Binding sitei376 – 3761SubstrateBy similarity
    Metal bindingi404 – 4041ManganeseBy similarity
    Binding sitei407 – 4071SubstrateBy similarity
    Binding sitei412 – 4121SubstrateBy similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. polypeptide N-acetylgalactosaminyltransferase activity Source: WormBase

    GO - Biological processi

    1. protein O-linked glycosylation via threonine Source: WormBase

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Keywords - Ligandi

    Lectin, Manganese, Metal-binding

    Enzyme and pathway databases

    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiCBM13. Carbohydrate-Binding Module Family 13.
    GT27. Glycosyltransferase Family 27.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Polypeptide N-acetylgalactosaminyltransferase 5 (EC:2.4.1.41)
    Short name:
    pp-GaNTase 5
    Alternative name(s):
    Protein-UDP acetylgalactosaminyltransferase 5
    UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5
    Gene namesi
    Name:gly-5
    ORF Names:Y39E4B.12
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome III

    Organism-specific databases

    WormBaseiY39E4B.12a; CE24240; WBGene00001630; gly-5.
    Y39E4B.12b; CE28119; WBGene00001630; gly-5.
    Y39E4B.12c; CE28120; WBGene00001630; gly-5.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 626626Polypeptide N-acetylgalactosaminyltransferase 5PRO_0000059148Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi32 – 321N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi165 ↔ 399PROSITE-ProRule annotation
    Glycosylationi338 – 3381N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi390 ↔ 466PROSITE-ProRule annotation
    Disulfide bondi502 ↔ 521PROSITE-ProRule annotation
    Disulfide bondi544 ↔ 557PROSITE-ProRule annotation
    Disulfide bondi583 ↔ 598PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ95ZJ1.
    PRIDEiQ95ZJ1.

    Interactioni

    Protein-protein interaction databases

    BioGridi41908. 4 interactions.
    DIPiDIP-26207N.
    IntActiQ95ZJ1. 3 interactions.
    MINTiMINT-1041440.
    STRINGi6239.Y39E4B.12a.1.

    Structurei

    3D structure databases

    ProteinModelPortaliQ95ZJ1.
    SMRiQ95ZJ1. Positions 154-607.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1111CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini32 – 626595LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei12 – 3120Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini488 – 610123Ricin B-type lectinPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni174 – 284111Catalytic subdomain AAdd
    BLAST
    Regioni345 – 40763Catalytic subdomain BAdd
    BLAST

    Domaini

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

    Sequence similaritiesi

    Contains 1 ricin B-type lectin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG239675.
    GeneTreeiENSGT00750000117385.
    HOGENOMiHOG000038227.
    InParanoidiQ95ZJ1.
    KOiK00710.
    OMAiYNENLPR.
    PhylomeDBiQ95ZJ1.

    Family and domain databases

    Gene3Di3.90.550.10. 1 hit.
    InterProiIPR001173. Glyco_trans_2-like.
    IPR029044. Nucleotide-diphossugar_trans.
    IPR000772. Ricin_B_lectin.
    [Graphical view]
    PfamiPF00535. Glycos_transf_2. 1 hit.
    PF00652. Ricin_B_lectin. 1 hit.
    [Graphical view]
    SMARTiSM00458. RICIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF50370. SSF50370. 1 hit.
    SSF53448. SSF53448. 1 hit.
    PROSITEiPS50231. RICIN_B_LECTIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q95ZJ1-1) [UniParc]FASTAAdd to Basket

    Also known as: GLY5b, GLY-5b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIIFKKKAIL KVLLLVPVFW ICSLIFFAAT SNDSSQIGSN NDLANKIAEA    50
    NFHPKAAKQD VIQGFGPPIE PEPVVENNKV EEEEQPGGNL AKPKFMVDPN 100
    DPIYKKGDAA QAGELGKAVV VDKTKLSTEE KAKYDKGMLN NAFNQYASDM 150
    ISVHRTLPTN IDAECKTEKY NENLPRTSVI ICFHNEAWSV LLRTVHSVLE 200
    RTPDHLLEEV VLVDDFSDMD HTKRPLEEYM SQFGGKVKIL RMEKREGLIR 250
    ARLRGAAVAT GEVLTYLDSH CECMEGWMEP LLDRIKRDPT TVVCPVIDVI 300
    DDNTFEYHHS KAYFTSVGGF DWGLQFNWHS IPERDRKNRT RPIDPVRSPT 350
    MAGGLFSIDK KYFEKLGTYD PGFDIWGGEN LELSFKIWMC GGTLEIVPCS 400
    HVGHVFRKRS PYKWRTGVNV LKRNSIRLAE VWLDDYKTYY YERINNQLGD 450
    FGDISSRKKL REDLGCKSFK WYLDNIYPEL FVPGESVAKG EVRNSAVQPA 500
    RCLDCMVGRH EKNRPVGTYQ CHGQGGNQYW MLSKDGEIRR DESCVDYAGS 550
    DVMVFPCHGM KGNQEWRYNH DTGRLQHAVS QKCLGMTKDG AKLEMVACQY 600
    DDPYQHWKFK EYNEAKAIEH GAKPPS 626
    Length:626
    Mass (Da):71,382
    Last modified:August 16, 2004 - v2
    Checksum:i561BD0576514B983
    GO
    Isoform b (identifier: Q95ZJ1-2) [UniParc]FASTAAdd to Basket

    Also known as: GLY5a, GLY-5a

    The sequence of this isoform differs from the canonical sequence as follows:
         492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → MRNAGGKNRQCIDYKPSGGKTVGMYQCHN

    Show »
    Length:623
    Mass (Da):71,014
    Checksum:i722AC7E93EF5FE4D
    GO
    Isoform c (identifier: Q95ZJ1-3) [UniParc]FASTAAdd to Basket

    Also known as: GLY5c, GLY-5c

    The sequence of this isoform differs from the canonical sequence as follows:
         492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → LRNAQTSQCLDSAVGEEVENKAITPYPCHE

    Show »
    Length:624
    Mass (Da):71,103
    Checksum:i4959436CAE9916D4
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti361 – 3611K → E in AAC13671. (PubMed:9525933)Curated
    Sequence conflicti361 – 3611K → E in AAC13672. (PubMed:9525933)Curated
    Sequence conflicti361 – 3611K → E in AAC13673. (PubMed:9525933)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei492 – 52332VRNSA…YQCHG → MRNAGGKNRQCIDYKPSGGK TVGMYQCHN in isoform b. 1 PublicationVSP_011238Add
    BLAST
    Alternative sequencei492 – 52332VRNSA…YQCHG → LRNAQTSQCLDSAVGEEVEN KAITPYPCHE in isoform c. 1 PublicationVSP_011239Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF031835 mRNA. Translation: AAC13671.1.
    AF031836 mRNA. Translation: AAC13672.1.
    AF031837 mRNA. Translation: AAC13673.1.
    AL110487 Genomic DNA. Translation: CAB54435.1.
    AL110487 Genomic DNA. Translation: CAC42369.1.
    AL110487 Genomic DNA. Translation: CAC42368.1.
    PIRiT42245.
    T42246.
    T42247.
    RefSeqiNP_001022850.1. NM_001027679.4. [Q95ZJ1-1]
    NP_001022851.1. NM_001027680.4. [Q95ZJ1-2]
    NP_001022852.1. NM_001027681.5. [Q95ZJ1-3]
    UniGeneiCel.19665.

    Genome annotation databases

    EnsemblMetazoaiY39E4B.12a.1; Y39E4B.12a.1; WBGene00001630. [Q95ZJ1-1]
    Y39E4B.12a.2; Y39E4B.12a.2; WBGene00001630. [Q95ZJ1-1]
    GeneIDi176736.
    KEGGicel:CELE_Y39E4B.12.
    UCSCiY39E4B.12c. c. elegans. [Q95ZJ1-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF031835 mRNA. Translation: AAC13671.1 .
    AF031836 mRNA. Translation: AAC13672.1 .
    AF031837 mRNA. Translation: AAC13673.1 .
    AL110487 Genomic DNA. Translation: CAB54435.1 .
    AL110487 Genomic DNA. Translation: CAC42369.1 .
    AL110487 Genomic DNA. Translation: CAC42368.1 .
    PIRi T42245.
    T42246.
    T42247.
    RefSeqi NP_001022850.1. NM_001027679.4. [Q95ZJ1-1 ]
    NP_001022851.1. NM_001027680.4. [Q95ZJ1-2 ]
    NP_001022852.1. NM_001027681.5. [Q95ZJ1-3 ]
    UniGenei Cel.19665.

    3D structure databases

    ProteinModelPortali Q95ZJ1.
    SMRi Q95ZJ1. Positions 154-607.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 41908. 4 interactions.
    DIPi DIP-26207N.
    IntActi Q95ZJ1. 3 interactions.
    MINTi MINT-1041440.
    STRINGi 6239.Y39E4B.12a.1.

    Protein family/group databases

    CAZyi CBM13. Carbohydrate-Binding Module Family 13.
    GT27. Glycosyltransferase Family 27.

    Proteomic databases

    PaxDbi Q95ZJ1.
    PRIDEi Q95ZJ1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai Y39E4B.12a.1 ; Y39E4B.12a.1 ; WBGene00001630 . [Q95ZJ1-1 ]
    Y39E4B.12a.2 ; Y39E4B.12a.2 ; WBGene00001630 . [Q95ZJ1-1 ]
    GeneIDi 176736.
    KEGGi cel:CELE_Y39E4B.12.
    UCSCi Y39E4B.12c. c. elegans. [Q95ZJ1-1 ]

    Organism-specific databases

    CTDi 176736.
    WormBasei Y39E4B.12a ; CE24240 ; WBGene00001630 ; gly-5.
    Y39E4B.12b ; CE28119 ; WBGene00001630 ; gly-5.
    Y39E4B.12c ; CE28120 ; WBGene00001630 ; gly-5.

    Phylogenomic databases

    eggNOGi NOG239675.
    GeneTreei ENSGT00750000117385.
    HOGENOMi HOG000038227.
    InParanoidi Q95ZJ1.
    KOi K00710.
    OMAi YNENLPR.
    PhylomeDBi Q95ZJ1.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .

    Miscellaneous databases

    NextBioi 893796.

    Family and domain databases

    Gene3Di 3.90.550.10. 1 hit.
    InterProi IPR001173. Glyco_trans_2-like.
    IPR029044. Nucleotide-diphossugar_trans.
    IPR000772. Ricin_B_lectin.
    [Graphical view ]
    Pfami PF00535. Glycos_transf_2. 1 hit.
    PF00652. Ricin_B_lectin. 1 hit.
    [Graphical view ]
    SMARTi SM00458. RICIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50370. SSF50370. 1 hit.
    SSF53448. SSF53448. 1 hit.
    PROSITEi PS50231. RICIN_B_LECTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning and expression of a family of UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase sequence homologs from Caenorhabditis elegans."
      Hagen F.K., Nehrke K.
      J. Biol. Chem. 273:8268-8277(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C).
      Strain: Bristol N2.
    2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Bristol N2.

    Entry informationi

    Entry nameiGALT5_CAEEL
    AccessioniPrimary (citable) accession number: Q95ZJ1
    Secondary accession number(s): O61391
    , O61392, O61393, Q95ZJ2, Q9U2J8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: August 16, 2004
    Last modified: October 1, 2014
    This is version 110 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3