Reviewed,
UniProtKB/Swiss-Prot Q95ZJ1 (GALT5_CAEEL)
Last modified
June 16, 2009.
Version 58.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Polypeptide N-acetylgalactosaminyltransferase 5 Short name=pp-GaNTase 5 EC=2.4.1.41 Alternative name(s): Protein-UDP acetylgalactosaminyltransferase 5 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Complete proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 626 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. |
| Catalytic activity | UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW polypeptide N-acetylgalactosaminyltransferase activityInferred from electronic annotation. Source: EC protein bindingInferred from physical interaction. Source: IntAct sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Q9TYJ7 | 1 | EBI-330445,EBI-330463 | ||
| prx-19 | P34453 | 1 | EBI-330445,EBI-320322 | |
| sgt-1 | Q21746 | 1 | EBI-330445,EBI-312019 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: Q95ZJ1-1) Also known as: GLY5b; GLY-5b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: Q95ZJ1-2) Also known as: GLY5a; GLY-5a; The sequence of this isoform differs from the canonical sequence as follows: 492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → MRNAGGKNRQCIDYKPSGGKTVGMYQCHN | ||||||
| Isoform c (identifier: Q95ZJ1-3) Also known as: GLY5c; GLY-5c; The sequence of this isoform differs from the canonical sequence as follows: 492-523: VRNSAVQPARCLDCMVGRHEKNRPVGTYQCHG → LRNAQTSQCLDSAVGEEVENKAITPYPCHE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 626 | 626 | Polypeptide N-acetylgalactosaminyltransferase 5 | PRO_0000059148 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 11 | 11 | Cytoplasmic Potential | ||||||||
| Transmembrane | 12 – 31 | 20 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 32 – 626 | 595 | Lumenal Potential | ||||||||
| Domain | 488 – 610 | 123 | Ricin B-type lectin | ||||||||
| Region | 174 – 284 | 111 | Catalytic subdomain A | ||||||||
| Region | 345 – 407 | 63 | Catalytic subdomain B | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 32 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 338 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 502 ↔ 521 | By similarity | |||||||||
| Disulfide bond | 544 ↔ 557 | By similarity | |||||||||
| Disulfide bond | 583 ↔ 598 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 492 – 523 | 32 | VRNSA…YQCHG → MRNAGGKNRQCIDYKPSGGK TVGMYQCHN in isoform b. | VSP_011238 | |||||||
| Alternative sequence | 492 – 523 | 32 | VRNSA…YQCHG → LRNAQTSQCLDSAVGEEVEN KAITPYPCHE in isoform c. | VSP_011239 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 361 | 1 | K → E in AAC13671. Ref.1 | ||||||||
| Sequence conflict | 361 | 1 | K → E in AAC13672. Ref.1 | ||||||||
| Sequence conflict | 361 | 1 | K → E in AAC13673. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning and expression of a family of UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase sequence homologs from Caenorhabditis elegans." Hagen F.K., Nehrke K. J. Biol. Chem. 273:8268-8277(1998) [PubMed: 9525933] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C). Strain: Bristol N2. |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Bristol N2. |
Cross-references
Sequence databases | |
|---|---|
| AF031835 mRNA. Translation: AAC13671.1. AF031836 mRNA. Translation: AAC13672.1. AF031837 mRNA. Translation: AAC13673.1. AL110487 Genomic DNA. Translation: CAB54435.1. AL110487 Genomic DNA. Translation: CAC42369.1. AL110487 Genomic DNA. Translation: CAC42368.1. | |
| PIR | T42245. T42246. T42247. |
| RefSeq | NP_001022850.1. |
| UniGene | Cel.19665 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1KNM based on UniProtKB P26514. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q95ZJ1. 4 interactions. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Proteomic databases | |
| PRIDE | Q95ZJ1. |
Genome annotation databases | |
| Ensembl | Y39E4B.12. Caenorhabditis elegans. [Contig view] |
| GeneID | 176736. |
| KEGG | cel:Y39E4B.12. |
Organism-specific databases | |
| WormBase | WBGene00001630. gly-5. |
| WormPep | Y39E4B.12a. CE24240. [WorfDB] Y39E4B.12b. CE28119. [WorfDB] Y39E4B.12c. CE28120. [WorfDB] |
Phylogenomic databases | |
| OMA | Q95ZJ1. SPYKWRT. |
Enzyme and pathway databases | |
| BRENDA | 2.4.1.41. 672. |
Gene expression databases | |
| ArrayExpress | Q95ZJ1. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR000772. Ricin_B_lectin. [Graphical view] |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 893796. |
Entry information
| Entry name | GALT5_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q95ZJ1 Secondary accession number(s): O61391 Q9U2J8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


