Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 60

Gene

Naa60

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.1 Publication
Isoform A: Shows histone acetyltransferase activity toward free histones.1 Publication
Isoform B: Does not show histone acetyltransferase activity toward free histones.1 Publication

Catalytic activityi

Acetyl-CoA + an N-terminal-L-methionyl-[transmembrane protein] = an N-terminal-N(alpha)-acetyl-L-methionyl-[transmembrane protein] + CoA.By similarity
Acetyl-CoA + [histone] = CoA + acetyl-[histone].1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei59SustrateBy similarity1
Binding sitei123SustrateBy similarity1
Active sitei139By similarity1
Binding sitei141SustrateBy similarity1
Active sitei180By similarity1

GO - Molecular functioni

  • H4 histone acetyltransferase activity Source: UniProtKB
  • histone acetyltransferase activity Source: UniProtKB-EC
  • peptide alpha-N-acetyltransferase activity Source: UniProtKB

GO - Biological processi

  • chromosome segregation Source: UniProtKB
  • histone acetylation Source: FlyBase
  • histone H4 acetylation Source: UniProtKB
  • N-terminal peptidyl-methionine acetylation Source: UniProtKB

Keywordsi

Molecular functionAcyltransferase, Chromatin regulator, Transferase
Biological processChromosome partition

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 60 (EC:2.3.1.259By similarity, EC:2.3.1.481 Publication)
Short name:
dNaa601 Publication
Alternative name(s):
NatF catalytic subunit
Gene namesi
Name:Naa60Imported
ORF Names:CG18177
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0036039. Naa60.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: FlyBase

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004133631 – 276N-alpha-acetyltransferase 60Add BLAST276

Proteomic databases

PaxDbiQ95SX8.
PRIDEiQ95SX8.

Expressioni

Gene expression databases

BgeeiFBgn0036039.
GenevisibleiQ95SX8. DM.

Interactioni

Protein-protein interaction databases

IntActiQ95SX8. 2 interactors.
STRINGi7227.FBpp0089006.

Structurei

3D structure databases

ProteinModelPortaliQ95SX8.
SMRiQ95SX8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 239N-acetyltransferasePROSITE-ProRule annotationAdd BLAST206

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni143 – 145Acetyl-CoA bindingBy similarity3
Regioni151 – 156Acetyl-CoA bindingBy similarity6
Regioni192 – 195Acetyl-CoA bindingBy similarity4
Regioni204 – 215Required for homodimerizationBy similarityAdd BLAST12

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410IQK0. Eukaryota.
ENOG410Y94A. LUCA.
GeneTreeiENSGT00390000008314.
InParanoidiQ95SX8.
KOiK21121.
OMAiIYRQAHS.
OrthoDBiEOG091G0L3L.
PhylomeDBiQ95SX8.

Family and domain databases

Gene3Di3.40.630.30. 2 hits.
InterProiView protein in InterPro
IPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
PfamiView protein in Pfam
PF00583. Acetyltransf_1. 1 hit.
SUPFAMiSSF55729. SSF55729. 2 hits.
PROSITEiView protein in PROSITE
PS51186. GNAT. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A1 Publication (identifier: Q95SX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQFTLYNKH SAPPSSESTR VDCEHVPLCS INDVQLRFLV PDDLTEVRQL
60 70 80 90 100
CQEWFPIDYP LSWYEDITSS TRFFALAAVY NLAIIGLIVA EIKPYRNVNK
110 120 130 140 150
EVIANMSDSD ELYTRLSGFP MQDKGILPDS MGRSADVGYI LSLGVHRSHR
160 170 180 190 200
RNGIGSLLLD ALMNHLTTAE RHSVKAIFLH TLTTNQPAIF FYEKRRFTLH
210 220 230 240 250
SFLPYYYNIR GKGKDGFTYV NYINGGHPPW TLLDHIKHYA SMVRHTSSLC
260 270
AWLAGRVQQV VRWFYHKLLT RFNFIE
Note: No experimental confirmation available.Curated
Length:276
Mass (Da):31,869
Last modified:December 1, 2001 - v1
Checksum:i45958EEBB2C3FFD3
GO
Isoform B1 Publication (identifier: Q95SX8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:255
Mass (Da):29,512
Checksum:i7B426F05C7A96DEE
GO
Isoform C1 Publication (identifier: Q95SX8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.
     234-276: DHIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHKLLTRFNFIE → YPFSKYLYALGCIAFLSMISLYFWLPS

Note: No experimental confirmation available.Curated
Show »
Length:239
Mass (Da):27,461
Checksum:i24E10C5B25881F1C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041889102 – 122Missing in isoform B and isoform C. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_041890234 – 276DHIKH…FNFIE → YPFSKYLYALGCIAFLSMIS LYFWLPS in isoform C. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014296 Genomic DNA. Translation: AAF50213.2.
AE014296 Genomic DNA. Translation: AAS65049.1.
AE014296 Genomic DNA. Translation: ACL83284.1.
AY060437 mRNA. Translation: AAL25476.1.
BT001491 mRNA. Translation: AAN71246.1.
RefSeqiNP_001137929.1. NM_001144457.3. [Q95SX8-3]
NP_648353.3. NM_140096.5. [Q95SX8-2]
NP_996032.1. NM_206310.3. [Q95SX8-1]
UniGeneiDm.917.

Genome annotation databases

EnsemblMetazoaiFBtr0089411; FBpp0089006; FBgn0036039. [Q95SX8-1]
GeneIDi39142.
KEGGidme:Dmel_CG18177.
UCSCiCG18177-RA. d. melanogaster. [Q95SX8-1]
CG18177-RB. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014296 Genomic DNA. Translation: AAF50213.2.
AE014296 Genomic DNA. Translation: AAS65049.1.
AE014296 Genomic DNA. Translation: ACL83284.1.
AY060437 mRNA. Translation: AAL25476.1.
BT001491 mRNA. Translation: AAN71246.1.
RefSeqiNP_001137929.1. NM_001144457.3. [Q95SX8-3]
NP_648353.3. NM_140096.5. [Q95SX8-2]
NP_996032.1. NM_206310.3. [Q95SX8-1]
UniGeneiDm.917.

3D structure databases

ProteinModelPortaliQ95SX8.
SMRiQ95SX8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ95SX8. 2 interactors.
STRINGi7227.FBpp0089006.

Proteomic databases

PaxDbiQ95SX8.
PRIDEiQ95SX8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0089411; FBpp0089006; FBgn0036039. [Q95SX8-1]
GeneIDi39142.
KEGGidme:Dmel_CG18177.
UCSCiCG18177-RA. d. melanogaster. [Q95SX8-1]
CG18177-RB. d. melanogaster.

Organism-specific databases

CTDi79903.
FlyBaseiFBgn0036039. Naa60.

Phylogenomic databases

eggNOGiENOG410IQK0. Eukaryota.
ENOG410Y94A. LUCA.
GeneTreeiENSGT00390000008314.
InParanoidiQ95SX8.
KOiK21121.
OMAiIYRQAHS.
OrthoDBiEOG091G0L3L.
PhylomeDBiQ95SX8.

Miscellaneous databases

GenomeRNAii39142.
PROiQ95SX8.

Gene expression databases

BgeeiFBgn0036039.
GenevisibleiQ95SX8. DM.

Family and domain databases

Gene3Di3.40.630.30. 2 hits.
InterProiView protein in InterPro
IPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
PfamiView protein in Pfam
PF00583. Acetyltransf_1. 1 hit.
SUPFAMiSSF55729. SSF55729. 2 hits.
PROSITEiView protein in PROSITE
PS51186. GNAT. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiNAA60_DROME
AccessioniPrimary (citable) accession number: Q95SX8
Secondary accession number(s): B7Z0F9, Q8IH11, Q9VT42
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2011
Last sequence update: December 1, 2001
Last modified: March 15, 2017
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.