Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q95SX8 (NAA60_DROME) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
N-alpha-acetyltransferase 60

Short name=dNaa60
EC=2.3.1.48
EC=2.3.1.88
Alternative name(s):
NatF catalytic subunit
Gene names
Name:Naa60
ORF Names:CG18177
OrganismDrosophila melanogaster (Fruit fly) [Reference proteome]
Taxonomic identifier7227 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Protein attributes

Sequence length276 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. Isoform A shows histone acetyltransferase activity toward free histones while isoform B does not. Ref.4 Ref.5

Catalytic activity

Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA. Ref.4 Ref.5

Acetyl-CoA + [histone] = CoA + acetyl-[histone]. Ref.4

Sequence similarities

Belongs to the acetyltransferase family. NAA60 subfamily.

Contains 1 N-acetyltransferase domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform A Ref.1 (identifier: Q95SX8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform B Ref.1 (identifier: Q95SX8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.
Note: No experimental confirmation available.
Isoform C Ref.1 (identifier: Q95SX8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.
     234-276: DHIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHKLLTRFNFIE → YPFSKYLYALGCIAFLSMISLYFWLPS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 276276N-alpha-acetyltransferase 60
PRO_0000413363

Regions

Domain34 – 239206N-acetyltransferase

Natural variations

Alternative sequence102 – 12221Missing in isoform B and isoform C. Ref.1
VSP_041889
Alternative sequence234 – 27643DHIKH…FNFIE → YPFSKYLYALGCIAFLSMIS LYFWLPS in isoform C. Ref.1
VSP_041890

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 45958EEBB2C3FFD3

FASTA27631,869
        10         20         30         40         50         60 
MAQFTLYNKH SAPPSSESTR VDCEHVPLCS INDVQLRFLV PDDLTEVRQL CQEWFPIDYP 

        70         80         90        100        110        120 
LSWYEDITSS TRFFALAAVY NLAIIGLIVA EIKPYRNVNK EVIANMSDSD ELYTRLSGFP 

       130        140        150        160        170        180 
MQDKGILPDS MGRSADVGYI LSLGVHRSHR RNGIGSLLLD ALMNHLTTAE RHSVKAIFLH 

       190        200        210        220        230        240 
TLTTNQPAIF FYEKRRFTLH SFLPYYYNIR GKGKDGFTYV NYINGGHPPW TLLDHIKHYA 

       250        260        270 
SMVRHTSSLC AWLAGRVQQV VRWFYHKLLT RFNFIE 

« Hide

Isoform B [UniParc].

Checksum: 7B426F05C7A96DEE
Show »

FASTA25529,512
Isoform C [UniParc].

Checksum: 24E10C5B25881F1C
Show »

FASTA23927,461

References

« Hide 'large scale' references
[1]"The genome sequence of Drosophila melanogaster."
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. expand/collapse author list , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[2]"Annotation of the Drosophila melanogaster euchromatic genome: a systematic review."
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. expand/collapse author list , Drysdale R.A., Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
Strain: Berkeley.
[3]"A Drosophila full-length cDNA resource."
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E.
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
Strain: Berkeley.
Tissue: Embryo.
[4]"HAT4, a Golgi apparatus-anchored B-type histone acetyltransferase, acetylates free histone H4 and facilitates chromatin assembly."
Yang X., Yu W., Shi L., Sun L., Liang J., Yi X., Li Q., Zhang Y., Yang F., Han X., Zhang D., Yang J., Yao Z., Shang Y.
Mol. Cell 44:39-50(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION (ISOFORM A), CATALYTIC ACTIVITY.
[5]"NatF contributes to an evolutionary shift in protein N-terminal acetylation and is important for normal chromosome segregation."
Van Damme P., Hole K., Pimenta-Marques A., Helsens K., Vandekerckhove J., Martinho R.G., Gevaert K., Arnesen T.
PLoS Genet. 7:E1002169-E1002169(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AE014296 Genomic DNA. Translation: AAF50213.2.
AE014296 Genomic DNA. Translation: AAS65049.1.
AE014296 Genomic DNA. Translation: ACL83284.1.
AY060437 mRNA. Translation: AAL25476.1.
BT001491 mRNA. Translation: AAN71246.1.
RefSeqNP_001137929.1. NM_001144457.3. [Q95SX8-3]
NP_648353.3. NM_140096.5. [Q95SX8-2]
NP_996032.1. NM_206310.3. [Q95SX8-1]
UniGeneDm.917.

3D structure databases

ProteinModelPortalQ95SX8.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PRIDEQ95SX8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaFBtr0089411; FBpp0089006; FBgn0036039. [Q95SX8-1]
GeneID39142.
KEGGdme:Dmel_CG18177.
UCSCCG18177-RA. d. melanogaster. [Q95SX8-1]
CG18177-RB. d. melanogaster.

Organism-specific databases

CTD79903.
FlyBaseFBgn0036039. Naa60.

Phylogenomic databases

eggNOGNOG276305.
GeneTreeENSGT00390000008314.
InParanoidQ9VT42.
OMAKEVIANM.
OrthoDBEOG7M0NT7.
PhylomeDBQ95SX8.

Gene expression databases

BgeeQ95SX8.

Family and domain databases

Gene3D3.40.630.30. 2 hits.
InterProIPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
[Graphical view]
PfamPF00583. Acetyltransf_1. 1 hit.
[Graphical view]
SUPFAMSSF55729. SSF55729. 2 hits.
PROSITEPS51186. GNAT. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi39142.
NextBio812130.
PROQ95SX8.

Entry information

Entry nameNAA60_DROME
AccessionPrimary (citable) accession number: Q95SX8
Secondary accession number(s): B7Z0F9, Q8IH11, Q9VT42
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2011
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Drosophila

Drosophila: entries, gene names and cross-references to FlyBase