Q95SX8 (NAA60_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: N-alpha-acetyltransferase 60 Short name=dNaa60 EC=2.3.1.48 EC=2.3.1.88 Alternative name(s): NatF catalytic subunit | ||
| Gene names |
| ||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||
| Taxonomic identifier | 7227 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 276 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. Isoform A has histone acetyltransferase toward free histones, while isoform B has no histone acetyltransferase activity. Ref.4 Ref.5 |
| Catalytic activity | Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA. Ref.4 Ref.5 Acetyl-CoA + [histone] = CoA + acetyl-[histone]. Ref.4 |
| Sequence similarities | Belongs to the acetyltransferase family. NAA60 subfamily. Contains 1 N-acetyltransferase domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Chromosome partition |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Acyltransferase Chromatin regulator Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | N-terminal peptidyl-methionine acetylation Inferred from direct assay Ref.5. Source: UniProtKB chromosome segregationInferred from mutant phenotype Ref.5. Source: UniProtKB histone acetylationInferred from electronic annotation. Source: GOC mitotic anaphaseInferred from mutant phenotype Ref.5. Source: FlyBase |
| Cellular_component | cytoplasm Inferred by curator Ref.5. Source: FlyBase |
| Molecular_function | H4 histone acetyltransferase activity Inferred from direct assay Ref.4. Source: UniProtKB histone acetyltransferase activityInferred from electronic annotation. Source: EC peptide alpha-N-acetyltransferase activityInferred from direct assay Ref.5. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A Ref.1 (identifier: Q95SX8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B Ref.1 (identifier: Q95SX8-2) The sequence of this isoform differs from the canonical sequence as follows: 102-122: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform C Ref.1 (identifier: Q95SX8-3) The sequence of this isoform differs from the canonical sequence as follows: 102-122: Missing. 234-276: DHIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHKLLTRFNFIE → YPFSKYLYALGCIAFLSMISLYFWLPS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 276 | 276 | N-alpha-acetyltransferase 60 | PRO_0000413363 | |||||
Regions | |||||||||
| Domain | 34 – 239 | 206 | N-acetyltransferase | ||||||
Natural variations | |||||||||
| Alternative sequence | 102 – 122 | 21 | Missing in isoform B and isoform C. Ref.1 | VSP_041889 | |||||
| Alternative sequence | 234 – 276 | 43 | DHIKH…FNFIE → YPFSKYLYALGCIAFLSMIS LYFWLPS in isoform C. Ref.1 | VSP_041890 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE014296 Genomic DNA. Translation: AAF50213.2. AE014296 Genomic DNA. Translation: AAS65049.1. AE014296 Genomic DNA. Translation: ACL83284.1. AY060437 mRNA. Translation: AAL25476.1. BT001491 mRNA. Translation: AAN71246.1. |
| RefSeq | NP_001137929.1. NM_001144457.3. NP_648353.3. NM_140096.5. NP_996032.1. NM_206310.3. |
| UniGene | Dm.917. |
3D structure databases | |
| ProteinModelPortal | Q95SX8. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q95SX8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0089411; FBpp0089006; FBgn0036039. |
| GeneID | 39142. |
| KEGG | dme:Dmel_CG18177. |
| UCSC | CG18177-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 79903. |
| FlyBase | FBgn0036039. CG18177. |
Phylogenomic databases | |
| eggNOG | NOG276305. |
| GeneTree | ENSGT00390000008314. |
| InParanoid | Q9VT42. |
| OMA | PWTILYP. |
| OrthoDB | EOG4VQ857. |
| PhylomeDB | Q95SX8. |
Gene expression databases | |
| Bgee | Q95SX8. |
Family and domain databases | |
| Gene3D | 3.40.630.30. 2 hits. |
| InterPro | IPR016181. Acyl_CoA_acyltransferase. IPR000182. GNAT_dom. [Graphical view] |
| Pfam | PF00583. Acetyltransf_1. 1 hit. [Graphical view] |
| SUPFAM | SSF55729. Acyl_CoA_acyltransferase. 1 hit. |
| PROSITE | PS51186. GNAT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 39142. |
| NextBio | 812130. |
Entry information
| Entry name | NAA60_DROME | ||||||||
| Accession | Primary (citable) accession number: Q95SX8 Secondary accession number(s): B7Z0F9, Q8IH11, Q9VT42 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
