Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q95SX8

- NAA60_DROME

UniProt

Q95SX8 - NAA60_DROME

Protein

N-alpha-acetyltransferase 60

Gene

Naa60

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. Isoform A shows histone acetyltransferase activity toward free histones while isoform B does not.1 Publication

    Catalytic activityi

    Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA.2 Publications
    Acetyl-CoA + [histone] = CoA + acetyl-[histone].1 Publication

    GO - Molecular functioni

    1. H4 histone acetyltransferase activity Source: UniProtKB
    2. histone acetyltransferase activity Source: UniProtKB-EC
    3. peptide alpha-N-acetyltransferase activity Source: UniProtKB

    GO - Biological processi

    1. chromosome segregation Source: UniProtKB
    2. histone H4 acetylation Source: UniProtKB
    3. N-terminal peptidyl-methionine acetylation Source: UniProtKB

    Keywords - Molecular functioni

    Acyltransferase, Chromatin regulator, Transferase

    Keywords - Biological processi

    Chromosome partition

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    N-alpha-acetyltransferase 60 (EC:2.3.1.48, EC:2.3.1.881 Publication)
    Short name:
    dNaa601 Publication
    Alternative name(s):
    NatF catalytic subunit
    Gene namesi
    Name:Naa60Imported
    ORF Names:CG18177
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome 3L

    Organism-specific databases

    FlyBaseiFBgn0036039. Naa60.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: FlyBase

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 276276N-alpha-acetyltransferase 60PRO_0000413363Add
    BLAST

    Proteomic databases

    PRIDEiQ95SX8.

    Expressioni

    Gene expression databases

    BgeeiQ95SX8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ95SX8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini34 – 239206N-acetyltransferasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 N-acetyltransferase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG276305.
    GeneTreeiENSGT00390000008314.
    InParanoidiQ9VT42.
    OMAiKEVIANM.
    OrthoDBiEOG7M0NT7.
    PhylomeDBiQ95SX8.

    Family and domain databases

    Gene3Di3.40.630.30. 2 hits.
    InterProiIPR016181. Acyl_CoA_acyltransferase.
    IPR000182. GNAT_dom.
    [Graphical view]
    PfamiPF00583. Acetyltransf_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF55729. SSF55729. 2 hits.
    PROSITEiPS51186. GNAT. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform A1 Publication (identifier: Q95SX8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQFTLYNKH SAPPSSESTR VDCEHVPLCS INDVQLRFLV PDDLTEVRQL    50
    CQEWFPIDYP LSWYEDITSS TRFFALAAVY NLAIIGLIVA EIKPYRNVNK 100
    EVIANMSDSD ELYTRLSGFP MQDKGILPDS MGRSADVGYI LSLGVHRSHR 150
    RNGIGSLLLD ALMNHLTTAE RHSVKAIFLH TLTTNQPAIF FYEKRRFTLH 200
    SFLPYYYNIR GKGKDGFTYV NYINGGHPPW TLLDHIKHYA SMVRHTSSLC 250
    AWLAGRVQQV VRWFYHKLLT RFNFIE 276

    Note: No experimental confirmation available.Curated

    Length:276
    Mass (Da):31,869
    Last modified:December 1, 2001 - v1
    Checksum:i45958EEBB2C3FFD3
    GO
    Isoform B1 Publication (identifier: Q95SX8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-122: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:255
    Mass (Da):29,512
    Checksum:i7B426F05C7A96DEE
    GO
    Isoform C1 Publication (identifier: Q95SX8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-122: Missing.
         234-276: DHIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHKLLTRFNFIE → YPFSKYLYALGCIAFLSMISLYFWLPS

    Note: No experimental confirmation available.Curated

    Show »
    Length:239
    Mass (Da):27,461
    Checksum:i24E10C5B25881F1C
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei102 – 12221Missing in isoform B and isoform C. 2 PublicationsVSP_041889Add
    BLAST
    Alternative sequencei234 – 27643DHIKH…FNFIE → YPFSKYLYALGCIAFLSMIS LYFWLPS in isoform C. 1 PublicationVSP_041890Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE014296 Genomic DNA. Translation: AAF50213.2.
    AE014296 Genomic DNA. Translation: AAS65049.1.
    AE014296 Genomic DNA. Translation: ACL83284.1.
    AY060437 mRNA. Translation: AAL25476.1.
    BT001491 mRNA. Translation: AAN71246.1.
    RefSeqiNP_001137929.1. NM_001144457.3. [Q95SX8-3]
    NP_648353.3. NM_140096.5. [Q95SX8-2]
    NP_996032.1. NM_206310.3. [Q95SX8-1]
    UniGeneiDm.917.

    Genome annotation databases

    EnsemblMetazoaiFBtr0089411; FBpp0089006; FBgn0036039. [Q95SX8-1]
    GeneIDi39142.
    KEGGidme:Dmel_CG18177.
    UCSCiCG18177-RA. d. melanogaster. [Q95SX8-1]
    CG18177-RB. d. melanogaster.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE014296 Genomic DNA. Translation: AAF50213.2 .
    AE014296 Genomic DNA. Translation: AAS65049.1 .
    AE014296 Genomic DNA. Translation: ACL83284.1 .
    AY060437 mRNA. Translation: AAL25476.1 .
    BT001491 mRNA. Translation: AAN71246.1 .
    RefSeqi NP_001137929.1. NM_001144457.3. [Q95SX8-3 ]
    NP_648353.3. NM_140096.5. [Q95SX8-2 ]
    NP_996032.1. NM_206310.3. [Q95SX8-1 ]
    UniGenei Dm.917.

    3D structure databases

    ProteinModelPortali Q95SX8.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PRIDEi Q95SX8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai FBtr0089411 ; FBpp0089006 ; FBgn0036039 . [Q95SX8-1 ]
    GeneIDi 39142.
    KEGGi dme:Dmel_CG18177.
    UCSCi CG18177-RA. d. melanogaster. [Q95SX8-1 ]
    CG18177-RB. d. melanogaster.

    Organism-specific databases

    CTDi 79903.
    FlyBasei FBgn0036039. Naa60.

    Phylogenomic databases

    eggNOGi NOG276305.
    GeneTreei ENSGT00390000008314.
    InParanoidi Q9VT42.
    OMAi KEVIANM.
    OrthoDBi EOG7M0NT7.
    PhylomeDBi Q95SX8.

    Miscellaneous databases

    GenomeRNAii 39142.
    NextBioi 812130.
    PROi Q95SX8.

    Gene expression databases

    Bgeei Q95SX8.

    Family and domain databases

    Gene3Di 3.40.630.30. 2 hits.
    InterProi IPR016181. Acyl_CoA_acyltransferase.
    IPR000182. GNAT_dom.
    [Graphical view ]
    Pfami PF00583. Acetyltransf_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55729. SSF55729. 2 hits.
    PROSITEi PS51186. GNAT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    2. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
      Strain: BerkeleyImported.
      Tissue: Embryo1 Publication.
    4. "HAT4, a Golgi apparatus-anchored B-type histone acetyltransferase, acetylates free histone H4 and facilitates chromatin assembly."
      Yang X., Yu W., Shi L., Sun L., Liang J., Yi X., Li Q., Zhang Y., Yang F., Han X., Zhang D., Yang J., Yao Z., Shang Y.
      Mol. Cell 44:39-50(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION (ISOFORM A), CATALYTIC ACTIVITY.
    5. "NatF contributes to an evolutionary shift in protein N-terminal acetylation and is important for normal chromosome segregation."
      Van Damme P., Hole K., Pimenta-Marques A., Helsens K., Vandekerckhove J., Martinho R.G., Gevaert K., Arnesen T.
      PLoS Genet. 7:E1002169-E1002169(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiNAA60_DROME
    AccessioniPrimary (citable) accession number: Q95SX8
    Secondary accession number(s): B7Z0F9, Q8IH11, Q9VT42
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2011
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 93 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3