Q94JU3 (CSN7_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: COP9 signalosome complex subunit 7 Short name=CSN complex subunit 7 Alternative name(s): Protein FUSCA 5 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis |
Protein attributes
| Sequence length | 260 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex. Ref.8 |
| Subunit structure | Component of the CSN complex, probably composed of CSN1, CSN2, CSN3, CSN4, CSN5 (CSN5A or CSN5B), CSN6 (CSN6A or CSN6B), CSN7 and CSN8. In the CSN complex, it probably interacts directly with CSN1, CSN4, CSN6 and CSN8. Also exists as a monomeric form. Interacts with EIF3S6/INT-6. Ref.1 Ref.7 Ref.9 |
| Subcellular location | |
| Post-translational modification | Phosphorylated. Ref.1 |
| Sequence similarities | Belongs to the CSN7/EIF3M family. CSN7 subfamily. Contains 1 PCI domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Phytochrome signaling pathway |
| Cellular component | Cytoplasm Nucleus Signalosome |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cullin deneddylation Inferred from mutant phenotype. Source: TAIR multicellular organismal developmentInferred from electronic annotation. Source: UniProtKB-KW red, far-red light phototransductionInferred from electronic annotation. Source: UniProtKB-KW signalosome assemblyInferred from mutant phenotype. Source: TAIR |
| Cellular component | cytosol Inferred from direct assay. Source: TAIR signalosomeInferred from physical interaction. Source: TAIR |
| Molecular function | protein binding Inferred from physical interaction Ref.1Ref.7Ref.9. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Q9M4T7 | 6 | EBI-531152,EBI-1635572 | ||
| CSN1 | P45432 | 3 | EBI-531152,EBI-530996 | |
| CSN4 | Q8L5U0 | 5 | EBI-531152,EBI-531074 | |
| CSN8 | P43255 | 3 | EBI-531152,EBI-530981 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q94JU3-1) Also known as: CSN7ii; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q94JU3-2) Also known as: CSN7i; The sequence of this isoform differs from the canonical sequence as follows: 224-260: GDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR → RE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 260 | 260 | COP9 signalosome complex subunit 7 | PRO_0000121003 | ||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||
| Domain | 60 – 156 | 97 | PCI | |||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 224 – 260 | 37 | GDVDI…HPVTR → RE in isoform 2. | VSP_011914 | ||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||
| Helix | 7 – 18 | 12 | ||||||||||||||||||||||||||||||||||
| Helix | 23 – 25 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 29 – 35 | 7 | ||||||||||||||||||||||||||||||||||
| Helix | 43 – 46 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 49 – 52 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 60 – 70 | 11 | ||||||||||||||||||||||||||||||||||
| Helix | 77 – 80 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 81 – 83 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 89 – 106 | 18 | ||||||||||||||||||||||||||||||||||
| Beta strand | 108 – 111 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 112 – 119 | 8 | ||||||||||||||||||||||||||||||||||
| Helix | 124 – 133 | 10 | ||||||||||||||||||||||||||||||||||
| Turn | 134 – 137 | 4 | ||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 146 | 3 | ||||||||||||||||||||||||||||||||||
| Turn | 147 – 150 | 4 | ||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 157 | 7 | ||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Arabidopsis FUSCA5 encodes a novel phosphoprotein that is a component of the COP9 complex." Karniol B., Malec P., Chamovitz D.A. Plant Cell 11:839-848(1999) [PubMed: 10330469] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PHOSPHORYLATION, SUBUNIT. |
| [2] | "Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome." Fu H., Reis N., Lee Y., Glickman M.H., Vierstra R. EMBO J. 20:7096-7107(2001) [PubMed: 11742986] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: cv. Columbia. |
| [3] | "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana." Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. Davis R.W.Nature 408:816-820(2000) [PubMed: 11130712] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [4] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [5] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [6] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7." Yahalom A., Kim T.-H., Winter E., Karniol B., von Arnim A.G., Chamovitz D.A. J. Biol. Chem. 276:334-340(2001) [PubMed: 11029466] [Abstract] Cited for: INTERACTION WITH EIF3S6. |
| [8] | "Interactions of the COP9 signalosome with the E3 ubiquitin ligase SCF(TIR1) in mediating auxin response." Schwechheimer C., Serino G., Callis J., Crosby W.L., Lyapina S., Deshaies R.J., Gray W.M., Estelle M., Deng X.-W. Science 292:1379-1382(2001) [PubMed: 11337587] [Abstract] Cited for: FUNCTION. |
| [9] | "Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex." Serino G., Su H., Peng Z., Tsuge T., Wei N., Gu H., Deng X.-W. Plant Cell 15:719-731(2003) [PubMed: 12615944] [Abstract] Cited for: INTERACTION WITH CSN1; CSN4; CSN6 AND CSN8. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF063852 mRNA. Translation: AAC25563.1. AF395065 mRNA. Translation: AAL58108.1. AF395066 mRNA. Translation: AAL58109.1. U89959 Genomic DNA. No translation available. CP002684 Genomic DNA. Translation: AEE27379.1. CP002684 Genomic DNA. Translation: AEE27380.1. AF372934 mRNA. Translation: AAK50074.1. AY133518 mRNA. Translation: AAM91348.1. AY087971 mRNA. Translation: AAM65518.1. | ||||||||||||
| IPI | IPI00523211. IPI00526282. | ||||||||||||
| PIR | T52188. | ||||||||||||
| RefSeq | NP_563645.1. NM_100089.2. NP_849576.1. NM_179245.2. | ||||||||||||
| UniGene | At.10718. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q94JU3. | ||||||||||||
| SMR | Q94JU3. Positions 4-164. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q94JU3. 23 interactions. | ||||||||||||
| STRING | Q94JU3. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q94JU3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| EnsemblPlants | AT1G02090.1; AT1G02090.1; AT1G02090. | ||||||||||||
| GeneID | 839241. | ||||||||||||
| GenomeReviews | Gene locus AT1G02090 in contig CT485782_GR. | ||||||||||||
| KEGG | ath:AT1G02090. | ||||||||||||
| NMPDR | fig|3702.1.peg.322. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneFarm | 4561. | ||||||||||||
| TAIR | At1g02090. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | KOG3250. | ||||||||||||
| GeneTree | EPGT00050000009211. | ||||||||||||
| HOGENOM | HBG715921. | ||||||||||||
| InParanoid | Q94JU3. | ||||||||||||
| OMA | VMDYEED. | ||||||||||||
| PhylomeDB | Q94JU3. | ||||||||||||
| ProtClustDB | CLSN2687617. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q94JU3. | ||||||||||||
| Genevestigator | Q94JU3. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000717. PCI_dom. [Graphical view] | ||||||||||||
| KO | K12180. | ||||||||||||
| Pfam | PF01399. PCI. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00088. PINT. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Entry information
| Entry name | CSN7_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q94JU3 Secondary accession number(s): O81247 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with