Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q94H98

- P2C34_ORYSJ

UniProt

Q94H98 - P2C34_ORYSJ

Protein

Probable protein phosphatase 2C 34

Gene

BIPP2C2

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    Cofactori

    Binds 2 magnesium or manganese ions per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi66 – 661Manganese 1By similarity
    Metal bindingi66 – 661Manganese 2By similarity
    Metal bindingi67 – 671Manganese 1; via carbonyl oxygenBy similarity
    Metal bindingi267 – 2671Manganese 2By similarity
    Metal bindingi326 – 3261Manganese 2By similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein serine/threonine phosphatase activity Source: InterPro

    GO - Biological processi

    1. protein dephosphorylation Source: InterPro

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Magnesium, Manganese, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable protein phosphatase 2C 34 (EC:3.1.3.16)
    Short name:
    OsPP2C34
    Alternative name(s):
    BTH-induced protein phosphatase 2C 2
    Short name:
    OsBIPP2C2
    Gene namesi
    Name:BIPP2C2
    Ordered Locus Names:Os03g0761100, LOC_Os03g55320
    ORF Names:OSJNBb0048A17.8
    OrganismiOryza sativa subsp. japonica (Rice)
    Taxonomic identifieri39947 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBEP cladeEhrhartoideaeOryzeaeOryza
    ProteomesiUP000000763: Chromosome 3

    Organism-specific databases

    GrameneiQ94H98.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 380380Probable protein phosphatase 2C 34PRO_0000363281Add
    BLAST

    Structurei

    3D structure databases

    ProteinModelPortaliQ94H98.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini26 – 307282PP2C-likeAdd
    BLAST

    Sequence similaritiesi

    Belongs to the PP2C family.Curated
    Contains 1 PP2C-like domain.Curated

    Phylogenomic databases

    eggNOGiCOG0631.
    OMAiAVARCCG.

    Family and domain databases

    Gene3Di3.60.40.10. 1 hit.
    InterProiIPR001932. PP2C-like_dom.
    IPR000222. PP2C_Mn2_Asp60_BS.
    IPR015655. Protein_Pase_2C.
    [Graphical view]
    PANTHERiPTHR13832. PTHR13832. 1 hit.
    PfamiPF00481. PP2C. 1 hit.
    [Graphical view]
    SMARTiSM00331. PP2C_SIG. 1 hit.
    SM00332. PP2Cc. 1 hit.
    [Graphical view]
    SUPFAMiSSF81606. SSF81606. 1 hit.
    PROSITEiPS01032. PP2C. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q94H98-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ    50
    AQVLASPAAT LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI 100
    RRAFGAAEEE FLQQVRQAWR QRPKMAAVGS CCLLGAISGD TLYVANLGDS 150
    RAVLGRRVVG GGVAVAERLT DEHNAASEEV RRELTALNPD DAQIVVHARG 200
    AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK RPALSAEPSI 250
    QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK 300
    EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS 350
    SNCTNAPVDI YSSNSGQSVE TLQAHRGSGW 380
    Length:380
    Mass (Da):41,754
    Last modified:December 1, 2001 - v1
    Checksum:iA52FA669C224987F
    GO
    Isoform 2 (identifier: Q94H98-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
         318-380: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:317
    Mass (Da):34,806
    Checksum:iB3765511788DEA42
    GO
    Isoform 3 (identifier: Q94H98-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
         256-380: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:255
    Mass (Da):27,659
    Checksum:i9F404754981AA892
    GO

    Sequence cautioni

    The sequence BAF13264.2 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei233 – 25523VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. CuratedVSP_036263Add
    BLAST
    Alternative sequencei256 – 380125Missing in isoform 3. CuratedVSP_036264Add
    BLAST
    Alternative sequencei288 – 31730TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. 1 PublicationVSP_036265Add
    BLAST
    Alternative sequencei318 – 38063Missing in isoform 2. 1 PublicationVSP_036266Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC084282 Genomic DNA. Translation: AAK63942.1.
    DP000009 Genomic DNA. Translation: ABF99005.1.
    DP000009 Genomic DNA. Translation: ABF99006.1.
    DP000009 Genomic DNA. Translation: ABF99007.1.
    AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems.
    AK066083 mRNA. Translation: BAG89811.1.
    AK102620 mRNA. Translation: BAG95642.1.
    RefSeqiNP_001051350.2. NM_001057885.2.
    UniGeneiOs.59314.

    Genome annotation databases

    EnsemblPlantsiOS03T0761100-01; OS03T0761100-01; OS03G0761100. [Q94H98-1]
    OS03T0761100-03; OS03T0761100-03; OS03G0761100. [Q94H98-1]
    GeneIDi4334191.
    KEGGiosa:4334191.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC084282 Genomic DNA. Translation: AAK63942.1 .
    DP000009 Genomic DNA. Translation: ABF99005.1 .
    DP000009 Genomic DNA. Translation: ABF99006.1 .
    DP000009 Genomic DNA. Translation: ABF99007.1 .
    AP008209 Genomic DNA. Translation: BAF13264.2 . Sequence problems.
    AK066083 mRNA. Translation: BAG89811.1 .
    AK102620 mRNA. Translation: BAG95642.1 .
    RefSeqi NP_001051350.2. NM_001057885.2.
    UniGenei Os.59314.

    3D structure databases

    ProteinModelPortali Q94H98.
    ModBasei Search...
    MobiDBi Search...

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi OS03T0761100-01 ; OS03T0761100-01 ; OS03G0761100 . [Q94H98-1 ]
    OS03T0761100-03 ; OS03T0761100-03 ; OS03G0761100 . [Q94H98-1 ]
    GeneIDi 4334191.
    KEGGi osa:4334191.

    Organism-specific databases

    Gramenei Q94H98.

    Phylogenomic databases

    eggNOGi COG0631.
    OMAi AVARCCG.

    Family and domain databases

    Gene3Di 3.60.40.10. 1 hit.
    InterProi IPR001932. PP2C-like_dom.
    IPR000222. PP2C_Mn2_Asp60_BS.
    IPR015655. Protein_Pase_2C.
    [Graphical view ]
    PANTHERi PTHR13832. PTHR13832. 1 hit.
    Pfami PF00481. PP2C. 1 hit.
    [Graphical view ]
    SMARTi SM00331. PP2C_SIG. 1 hit.
    SM00332. PP2Cc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF81606. SSF81606. 1 hit.
    PROSITEi PS01032. PP2C. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Sequence, annotation, and analysis of synteny between rice chromosome 3 and diverged grass species."
      The rice chromosome 3 sequencing consortium
      Buell C.R., Yuan Q., Ouyang S., Liu J., Zhu W., Wang A., Maiti R., Haas B., Wortman J., Pertea M., Jones K.M., Kim M., Overton L., Tsitrin T., Fadrosh D., Bera J., Weaver B., Jin S.
      , Johri S., Reardon M., Webb K., Hill J., Moffat K., Tallon L., Van Aken S., Lewis M., Utterback T., Feldblyum T., Zismann V., Iobst S., Hsiao J., de Vazeille A.R., Salzberg S.L., White O., Fraser C.M., Yu Y., Kim H., Rambo T., Currie J., Collura K., Kernodle-Thompson S., Wei F., Kudrna K., Ammiraju J.S.S., Luo M., Goicoechea J.L., Wing R.A., Henry D., Oates R., Palmer M., Pries G., Saski C., Simmons J., Soderlund C., Nelson W., de la Bastide M., Spiegel L., Nascimento L., Huang E., Preston R., Zutavern T., Palmer L., O'Shaughnessy A., Dike S., McCombie W.R., Minx P., Cordum H., Wilson R., Jin W., Lee H.R., Jiang J., Jackson S.
      Genome Res. 15:1284-1291(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Nipponbare.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Nipponbare.
    3. "The rice annotation project database (RAP-DB): 2008 update."
      The rice annotation project (RAP)
      Nucleic Acids Res. 36:D1028-D1033(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENOME REANNOTATION.
      Strain: cv. Nipponbare.
    4. "Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice."
      The rice full-length cDNA consortium
      Science 301:376-379(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: cv. Nipponbare.
    5. "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
      Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
      BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENE FAMILY, NOMENCLATURE.

    Entry informationi

    Entry nameiP2C34_ORYSJ
    AccessioniPrimary (citable) accession number: Q94H98
    Secondary accession number(s): Q10EH6, Q10EH8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 10, 2009
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Oryza sativa (rice)
      Index of Oryza sativa entries and their corresponding gene designations
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3