Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q94H98

- P2C34_ORYSJ

UniProt

Q94H98 - P2C34_ORYSJ

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Probable protein phosphatase 2C 34

Gene

BIPP2C2

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Binds 2 magnesium or manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi66 – 661Manganese 1By similarity
Metal bindingi66 – 661Manganese 2By similarity
Metal bindingi67 – 671Manganese 1; via carbonyl oxygenBy similarity
Metal bindingi267 – 2671Manganese 2By similarity
Metal bindingi326 – 3261Manganese 2By similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein serine/threonine phosphatase activity Source: InterPro

GO - Biological processi

  1. protein dephosphorylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable protein phosphatase 2C 34 (EC:3.1.3.16)
Short name:
OsPP2C34
Alternative name(s):
BTH-induced protein phosphatase 2C 2
Short name:
OsBIPP2C2
Gene namesi
Name:BIPP2C2
Ordered Locus Names:Os03g0761100, LOC_Os03g55320
ORF Names:OSJNBb0048A17.8
OrganismiOryza sativa subsp. japonica (Rice)
Taxonomic identifieri39947 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBEP cladeEhrhartoideaeOryzeaeOryza
ProteomesiUP000000763: Chromosome 3

Organism-specific databases

GrameneiQ94H98.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 380380Probable protein phosphatase 2C 34PRO_0000363281Add
BLAST

Expressioni

Gene expression databases

ExpressionAtlasiQ94H98. baseline.

Structurei

3D structure databases

ProteinModelPortaliQ94H98.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 307282PP2C-likeAdd
BLAST

Sequence similaritiesi

Belongs to the PP2C family.Curated
Contains 1 PP2C-like domain.Curated

Phylogenomic databases

eggNOGiCOG0631.
InParanoidiQ94H98.
OMAiAVARCCG.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS01032. PP2C. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q94H98-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ
60 70 80 90 100
AQVLASPAAT LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI
110 120 130 140 150
RRAFGAAEEE FLQQVRQAWR QRPKMAAVGS CCLLGAISGD TLYVANLGDS
160 170 180 190 200
RAVLGRRVVG GGVAVAERLT DEHNAASEEV RRELTALNPD DAQIVVHARG
210 220 230 240 250
AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK RPALSAEPSI
260 270 280 290 300
QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK
310 320 330 340 350
EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS
360 370 380
SNCTNAPVDI YSSNSGQSVE TLQAHRGSGW
Length:380
Mass (Da):41,754
Last modified:December 1, 2001 - v1
Checksum:iA52FA669C224987F
GO
Isoform 2 (identifier: Q94H98-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
     318-380: Missing.

Note: No experimental confirmation available.

Show »
Length:317
Mass (Da):34,806
Checksum:iB3765511788DEA42
GO
Isoform 3 (identifier: Q94H98-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
     256-380: Missing.

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):27,659
Checksum:i9F404754981AA892
GO

Sequence cautioni

The sequence BAF13264.2 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei233 – 25523VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. CuratedVSP_036263Add
BLAST
Alternative sequencei256 – 380125Missing in isoform 3. CuratedVSP_036264Add
BLAST
Alternative sequencei288 – 31730TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. 1 PublicationVSP_036265Add
BLAST
Alternative sequencei318 – 38063Missing in isoform 2. 1 PublicationVSP_036266Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC084282 Genomic DNA. Translation: AAK63942.1.
DP000009 Genomic DNA. Translation: ABF99005.1.
DP000009 Genomic DNA. Translation: ABF99006.1.
DP000009 Genomic DNA. Translation: ABF99007.1.
AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems.
AK066083 mRNA. Translation: BAG89811.1.
AK102620 mRNA. Translation: BAG95642.1.
RefSeqiNP_001051350.2. NM_001057885.2.
UniGeneiOs.59314.

Genome annotation databases

EnsemblPlantsiOS03T0761100-01; OS03T0761100-01; OS03G0761100. [Q94H98-1]
OS03T0761100-03; OS03T0761100-03; OS03G0761100. [Q94H98-1]
GeneIDi4334191.
KEGGiosa:4334191.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC084282 Genomic DNA. Translation: AAK63942.1 .
DP000009 Genomic DNA. Translation: ABF99005.1 .
DP000009 Genomic DNA. Translation: ABF99006.1 .
DP000009 Genomic DNA. Translation: ABF99007.1 .
AP008209 Genomic DNA. Translation: BAF13264.2 . Sequence problems.
AK066083 mRNA. Translation: BAG89811.1 .
AK102620 mRNA. Translation: BAG95642.1 .
RefSeqi NP_001051350.2. NM_001057885.2.
UniGenei Os.59314.

3D structure databases

ProteinModelPortali Q94H98.
ModBasei Search...
MobiDBi Search...

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi OS03T0761100-01 ; OS03T0761100-01 ; OS03G0761100 . [Q94H98-1 ]
OS03T0761100-03 ; OS03T0761100-03 ; OS03G0761100 . [Q94H98-1 ]
GeneIDi 4334191.
KEGGi osa:4334191.

Organism-specific databases

Gramenei Q94H98.

Phylogenomic databases

eggNOGi COG0631.
InParanoidi Q94H98.
OMAi AVARCCG.

Gene expression databases

ExpressionAtlasi Q94H98. baseline.

Family and domain databases

Gene3Di 3.60.40.10. 1 hit.
InterProi IPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view ]
PANTHERi PTHR13832. PTHR13832. 1 hit.
Pfami PF00481. PP2C. 1 hit.
[Graphical view ]
SMARTi SM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view ]
SUPFAMi SSF81606. SSF81606. 1 hit.
PROSITEi PS01032. PP2C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence, annotation, and analysis of synteny between rice chromosome 3 and diverged grass species."
    The rice chromosome 3 sequencing consortium
    Buell C.R., Yuan Q., Ouyang S., Liu J., Zhu W., Wang A., Maiti R., Haas B., Wortman J., Pertea M., Jones K.M., Kim M., Overton L., Tsitrin T., Fadrosh D., Bera J., Weaver B., Jin S.
    , Johri S., Reardon M., Webb K., Hill J., Moffat K., Tallon L., Van Aken S., Lewis M., Utterback T., Feldblyum T., Zismann V., Iobst S., Hsiao J., de Vazeille A.R., Salzberg S.L., White O., Fraser C.M., Yu Y., Kim H., Rambo T., Currie J., Collura K., Kernodle-Thompson S., Wei F., Kudrna K., Ammiraju J.S.S., Luo M., Goicoechea J.L., Wing R.A., Henry D., Oates R., Palmer M., Pries G., Saski C., Simmons J., Soderlund C., Nelson W., de la Bastide M., Spiegel L., Nascimento L., Huang E., Preston R., Zutavern T., Palmer L., O'Shaughnessy A., Dike S., McCombie W.R., Minx P., Cordum H., Wilson R., Jin W., Lee H.R., Jiang J., Jackson S.
    Genome Res. 15:1284-1291(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Nipponbare.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Nipponbare.
  3. "The rice annotation project database (RAP-DB): 2008 update."
    The rice annotation project (RAP)
    Nucleic Acids Res. 36:D1028-D1033(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENOME REANNOTATION.
    Strain: cv. Nipponbare.
  4. "Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice."
    The rice full-length cDNA consortium
    Science 301:376-379(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: cv. Nipponbare.
  5. "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
    Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
    BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.

Entry informationi

Entry nameiP2C34_ORYSJ
AccessioniPrimary (citable) accession number: Q94H98
Secondary accession number(s): Q10EH6, Q10EH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Oryza sativa (rice)
    Index of Oryza sativa entries and their corresponding gene designations
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3