Q94H98 (P2C34_ORYSJ) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable protein phosphatase 2C 34 Short name=OsPP2C34 EC=3.1.3.16 Alternative name(s): BTH-induced protein phosphatase 2C 2 Short name=OsBIPP2C2 | ||||||
| Gene names |
| ||||||
| Organism | Oryza sativa subsp. japonica (Rice) [Reference proteome] | ||||||
| Taxonomic identifier | 39947 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › Liliopsida › Poales › Poaceae › BEP clade › Ehrhartoideae › Oryzeae › Oryza › ![]() |
Protein attributes
| Sequence length | 380 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 2 magnesium or manganese ions per subunit By similarity. |
| Sequence similarities | Belongs to the PP2C family. Contains 1 PP2C-like domain. |
| Sequence caution | The sequence BAF13264.2 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Manganese Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein dephosphorylation Inferred from electronic annotation. Source: InterPro |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q94H98-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q94H98-2) The sequence of this isoform differs from the canonical sequence as follows: 288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ 318-380: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q94H98-3) The sequence of this isoform differs from the canonical sequence as follows: 233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV 256-380: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 380 | 380 | Probable protein phosphatase 2C 34 | PRO_0000363281 | |||||
Regions | |||||||||
| Domain | 26 – 307 | 282 | PP2C-like | ||||||
Sites | |||||||||
| Metal binding | 66 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 66 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 67 | 1 | Manganese 1; via carbonyl oxygen By similarity | ||||||
| Metal binding | 267 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 326 | 1 | Manganese 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 233 – 255 | 23 | VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. | VSP_036263 | |||||
| Alternative sequence | 256 – 380 | 125 | Missing in isoform 3. | VSP_036264 | |||||
| Alternative sequence | 288 – 317 | 30 | TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. | VSP_036265 | |||||
| Alternative sequence | 318 – 380 | 63 | Missing in isoform 2. | VSP_036266 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence, annotation, and analysis of synteny between rice chromosome 3 and diverged grass species." The rice chromosome 3 sequencing consortium Buell C.R., Yuan Q., Ouyang S., Liu J., Zhu W., Wang A., Maiti R., Haas B., Wortman J., Pertea M., Jones K.M., Kim M., Overton L., Tsitrin T., Fadrosh D., Bera J., Weaver B., Jin S. Jackson S.Genome Res. 15:1284-1291(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Nipponbare. |
| [2] | "The map-based sequence of the rice genome." International rice genome sequencing project (IRGSP) Nature 436:793-800(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Nipponbare. |
| [3] | "The rice annotation project database (RAP-DB): 2008 update." The rice annotation project (RAP) Nucleic Acids Res. 36:D1028-D1033(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION. Strain: cv. Nipponbare. |
| [4] | "Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice." The rice full-length cDNA consortium Science 301:376-379(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: cv. Nipponbare. |
| [5] | "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis." Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y. BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC084282 Genomic DNA. Translation: AAK63942.1. DP000009 Genomic DNA. Translation: ABF99005.1. DP000009 Genomic DNA. Translation: ABF99006.1. DP000009 Genomic DNA. Translation: ABF99007.1. AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems. AK066083 mRNA. Translation: BAG89811.1. AK102620 mRNA. Translation: BAG95642.1. |
| RefSeq | NP_001051350.2. NM_001057885.2. |
| UniGene | Os.59314. |
3D structure databases | |
| ProteinModelPortal | Q94H98. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | LOC_Os03g55320.1; LOC_Os03g55320.1; LOC_Os03g55320. |
| GeneID | 4334191. |
| KEGG | osa:4334191. |
Organism-specific databases | |
| Gramene | Q94H98. |
Phylogenomic databases | |
| eggNOG | COG0631. |
| OMA | RAVARCC. |
| ProtClustDB | CLSN2694321. |
Gene expression databases | |
| ArrayExpress | Q94H98. |
Family and domain databases | |
| Gene3D | 3.60.40.10. 1 hit. |
| InterPro | IPR001932. PP2C-like. IPR000222. PP2C_Mn2_Asp60_BS. IPR015655. Protein_Pase_2C. [Graphical view] |
| PANTHER | PTHR13832. PTHR13832. 1 hit. |
| Pfam | PF00481. PP2C. 1 hit. [Graphical view] |
| SMART | SM00331. PP2C_SIG. 1 hit. SM00332. PP2Cc. 1 hit. [Graphical view] |
| SUPFAM | SSF81606. PP2C-related. 1 hit. |
| PROSITE | PS01032. PP2C. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | P2C34_ORYSJ | ||||||||
| Accession | Primary (citable) accession number: Q94H98 Secondary accession number(s): Q10EH6, Q10EH8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Oryza sativa (rice) Index of Oryza sativa entries and their corresponding gene designations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
