Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable protein phosphatase 2C 34

Gene

BIPP2C2

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Mg2+By similarity, Mn2+By similarityNote: Binds 2 magnesium or manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi66Manganese 1By similarity1
Metal bindingi66Manganese 2By similarity1
Metal bindingi67Manganese 1; via carbonyl oxygenBy similarity1
Metal bindingi267Manganese 2By similarity1
Metal bindingi326Manganese 2By similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable protein phosphatase 2C 34 (EC:3.1.3.16)
Short name:
OsPP2C34
Alternative name(s):
BTH-induced protein phosphatase 2C 2
Short name:
OsBIPP2C2
Gene namesi
Name:BIPP2C2
Ordered Locus Names:Os03g0761100, LOC_Os03g55320
ORF Names:OsJ_12676Imported, OSJNBb0048A17.8
OrganismiOryza sativa subsp. japonica (Rice)
Taxonomic identifieri39947 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBOP cladeOryzoideaeOryzeaeOryzinaeOryza
Proteomesi
  • UP000059680 Componenti: Chromosome 3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003632811 – 380Probable protein phosphatase 2C 34Add BLAST380

Proteomic databases

PaxDbiQ94H98.

Expressioni

Gene expression databases

ExpressionAtlasiQ94H98. baseline and differential.
GenevisibleiQ94H98. OS.

Interactioni

Protein-protein interaction databases

STRINGi39947.LOC_Os03g55320.1.

Structurei

3D structure databases

ProteinModelPortaliQ94H98.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 335PPM-type phosphatasePROSITE-ProRule annotationAdd BLAST304

Sequence similaritiesi

Belongs to the PP2C family.Curated
Contains 1 PPM-type phosphatase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0700. Eukaryota.
COG0631. LUCA.
InParanoidiQ94H98.
OMAiYSSNTHQ.
OrthoDBiEOG09360G56.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR015655. PP2C.
IPR000222. PP2C_BS.
IPR001932. PPM-type_phosphatase_dom.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 2 hits.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS01032. PPM_1. 1 hit.
PS51746. PPM_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q94H98-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ
60 70 80 90 100
AQVLASPAAT LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI
110 120 130 140 150
RRAFGAAEEE FLQQVRQAWR QRPKMAAVGS CCLLGAISGD TLYVANLGDS
160 170 180 190 200
RAVLGRRVVG GGVAVAERLT DEHNAASEEV RRELTALNPD DAQIVVHARG
210 220 230 240 250
AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK RPALSAEPSI
260 270 280 290 300
QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK
310 320 330 340 350
EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS
360 370 380
SNCTNAPVDI YSSNSGQSVE TLQAHRGSGW
Length:380
Mass (Da):41,754
Last modified:December 1, 2001 - v1
Checksum:iA52FA669C224987F
GO
Isoform 2 (identifier: Q94H98-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
     318-380: Missing.

Note: No experimental confirmation available.
Show »
Length:317
Mass (Da):34,806
Checksum:iB3765511788DEA42
GO
Isoform 3 (identifier: Q94H98-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
     256-380: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):27,659
Checksum:i9F404754981AA892
GO

Sequence cautioni

The sequence BAF13264 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036263233 – 255VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3. CuratedAdd BLAST23
Alternative sequenceiVSP_036264256 – 380Missing in isoform 3. CuratedAdd BLAST125
Alternative sequenceiVSP_036265288 – 317TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_036266318 – 380Missing in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084282 Genomic DNA. Translation: AAK63942.1.
DP000009 Genomic DNA. Translation: ABF99005.1.
DP000009 Genomic DNA. Translation: ABF99006.1.
DP000009 Genomic DNA. Translation: ABF99007.1.
AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems.
AP014959 Genomic DNA. Translation: BAS86507.1.
AP014959 Genomic DNA. Translation: BAS86508.1.
CM000140 Genomic DNA. Translation: EEE59974.1.
AK066083 mRNA. Translation: BAG89811.1.
AK102620 mRNA. Translation: BAG95642.1.
RefSeqiXP_015631940.1. XM_015776454.1. [Q94H98-1]
UniGeneiOs.59314.

Genome annotation databases

EnsemblPlantsiOS03T0761100-01; OS03T0761100-01; OS03G0761100. [Q94H98-1]
OS03T0761100-03; OS03T0761100-03; OS03G0761100. [Q94H98-1]
GeneIDi4334191.
GrameneiOS03T0761100-01; OS03T0761100-01; OS03G0761100.
OS03T0761100-03; OS03T0761100-03; OS03G0761100.
KEGGiosa:4334191.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC084282 Genomic DNA. Translation: AAK63942.1.
DP000009 Genomic DNA. Translation: ABF99005.1.
DP000009 Genomic DNA. Translation: ABF99006.1.
DP000009 Genomic DNA. Translation: ABF99007.1.
AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems.
AP014959 Genomic DNA. Translation: BAS86507.1.
AP014959 Genomic DNA. Translation: BAS86508.1.
CM000140 Genomic DNA. Translation: EEE59974.1.
AK066083 mRNA. Translation: BAG89811.1.
AK102620 mRNA. Translation: BAG95642.1.
RefSeqiXP_015631940.1. XM_015776454.1. [Q94H98-1]
UniGeneiOs.59314.

3D structure databases

ProteinModelPortaliQ94H98.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi39947.LOC_Os03g55320.1.

Proteomic databases

PaxDbiQ94H98.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiOS03T0761100-01; OS03T0761100-01; OS03G0761100. [Q94H98-1]
OS03T0761100-03; OS03T0761100-03; OS03G0761100. [Q94H98-1]
GeneIDi4334191.
GrameneiOS03T0761100-01; OS03T0761100-01; OS03G0761100.
OS03T0761100-03; OS03T0761100-03; OS03G0761100.
KEGGiosa:4334191.

Phylogenomic databases

eggNOGiKOG0700. Eukaryota.
COG0631. LUCA.
InParanoidiQ94H98.
OMAiYSSNTHQ.
OrthoDBiEOG09360G56.

Gene expression databases

ExpressionAtlasiQ94H98. baseline and differential.
GenevisibleiQ94H98. OS.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR015655. PP2C.
IPR000222. PP2C_BS.
IPR001932. PPM-type_phosphatase_dom.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 2 hits.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS01032. PPM_1. 1 hit.
PS51746. PPM_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiP2C34_ORYSJ
AccessioniPrimary (citable) accession number: Q94H98
Secondary accession number(s): B9F5U1, Q10EH6, Q10EH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Oryza sativa (rice)
    Index of Oryza sativa entries and their corresponding gene designations
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.