Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q94H98 (P2C34_ORYSJ) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable protein phosphatase 2C 34

Short name=OsPP2C34
EC=3.1.3.16
Alternative name(s):
BTH-induced protein phosphatase 2C 2
Short name=OsBIPP2C2
Gene names
Name:BIPP2C2
Ordered Locus Names:Os03g0761100, LOC_Os03g55320
ORF Names:OSJNBb0048A17.8
OrganismOryza sativa subsp. japonica (Rice) [Reference proteome]
Taxonomic identifier39947 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaLiliopsidaPoalesPoaceaeBEP cladeEhrhartoideaeOryzeaeOryza

Protein attributes

Sequence length380 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactor

Binds 2 magnesium or manganese ions per subunit By similarity.

Sequence similarities

Belongs to the PP2C family.

Contains 1 PP2C-like domain.

Sequence caution

The sequence BAF13264.2 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q94H98-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q94H98-2)

The sequence of this isoform differs from the canonical sequence as follows:
     288-317: TGIANRLVKAALKEATRKREVSFRDLKTIE → TVSSDNIYSIRSFHHREYIFPVNERGVLTQ
     318-380: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q94H98-3)

The sequence of this isoform differs from the canonical sequence as follows:
     233-255: VGPPIPLKRPALSAEPSIQVRKL → MVSGSISVTTLRCRLSSRIQGRV
     256-380: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 380380Probable protein phosphatase 2C 34
PRO_0000363281

Regions

Domain26 – 307282PP2C-like

Sites

Metal binding661Manganese 1 By similarity
Metal binding661Manganese 2 By similarity
Metal binding671Manganese 1; via carbonyl oxygen By similarity
Metal binding2671Manganese 2 By similarity
Metal binding3261Manganese 2 By similarity

Natural variations

Alternative sequence233 – 25523VGPPI…QVRKL → MVSGSISVTTLRCRLSSRIQ GRV in isoform 3.
VSP_036263
Alternative sequence256 – 380125Missing in isoform 3.
VSP_036264
Alternative sequence288 – 31730TGIAN…LKTIE → TVSSDNIYSIRSFHHREYIF PVNERGVLTQ in isoform 2.
VSP_036265
Alternative sequence318 – 38063Missing in isoform 2.
VSP_036266

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: A52FA669C224987F

FASTA38041,754
        10         20         30         40         50         60 
MLRAVARCCG HWPPGAAAAD GMLWQTELRP HAAGEFSMAA AQANLAMEDQ AQVLASPAAT 

        70         80         90        100        110        120 
LVGVYDGHGG ADASRFLRSR LFPHVQRFEK EQGGMSTEVI RRAFGAAEEE FLQQVRQAWR 

       130        140        150        160        170        180 
QRPKMAAVGS CCLLGAISGD TLYVANLGDS RAVLGRRVVG GGVAVAERLT DEHNAASEEV 

       190        200        210        220        230        240 
RRELTALNPD DAQIVVHARG AWRVKGIIQV SRTIGDVYLK KQEYSMDPVF RNVGPPIPLK 

       250        260        270        280        290        300 
RPALSAEPSI QVRKLKPNDL FLIFASDGLW EHLSDDAAVQ IVFKNPRTGI ANRLVKAALK 

       310        320        330        340        350        360 
EATRKREVSF RDLKTIEKGV RRHFHDDISV IVVYLDRHRG RRHTRVVDSS SNCTNAPVDI 

       370        380 
YSSNSGQSVE TLQAHRGSGW 

« Hide

Isoform 2 [UniParc].

Checksum: B3765511788DEA42
Show »

FASTA31734,806
Isoform 3 [UniParc].

Checksum: 9F404754981AA892
Show »

FASTA25527,659

References

« Hide 'large scale' references
[1]"Sequence, annotation, and analysis of synteny between rice chromosome 3 and diverged grass species."
The rice chromosome 3 sequencing consortium
Buell C.R., Yuan Q., Ouyang S., Liu J., Zhu W., Wang A., Maiti R., Haas B., Wortman J., Pertea M., Jones K.M., Kim M., Overton L., Tsitrin T., Fadrosh D., Bera J., Weaver B., Jin S. expand/collapse author list , Johri S., Reardon M., Webb K., Hill J., Moffat K., Tallon L., Van Aken S., Lewis M., Utterback T., Feldblyum T., Zismann V., Iobst S., Hsiao J., de Vazeille A.R., Salzberg S.L., White O., Fraser C.M., Yu Y., Kim H., Rambo T., Currie J., Collura K., Kernodle-Thompson S., Wei F., Kudrna K., Ammiraju J.S.S., Luo M., Goicoechea J.L., Wing R.A., Henry D., Oates R., Palmer M., Pries G., Saski C., Simmons J., Soderlund C., Nelson W., de la Bastide M., Spiegel L., Nascimento L., Huang E., Preston R., Zutavern T., Palmer L., O'Shaughnessy A., Dike S., McCombie W.R., Minx P., Cordum H., Wilson R., Jin W., Lee H.R., Jiang J., Jackson S.
Genome Res. 15:1284-1291(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Nipponbare.
[2]"The map-based sequence of the rice genome."
International rice genome sequencing project (IRGSP)
Nature 436:793-800(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Nipponbare.
[3]"The rice annotation project database (RAP-DB): 2008 update."
The rice annotation project (RAP)
Nucleic Acids Res. 36:D1028-D1033(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION.
Strain: cv. Nipponbare.
[4]"Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice."
The rice full-length cDNA consortium
Science 301:376-379(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: cv. Nipponbare.
[5]"Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC084282 Genomic DNA. Translation: AAK63942.1.
DP000009 Genomic DNA. Translation: ABF99005.1.
DP000009 Genomic DNA. Translation: ABF99006.1.
DP000009 Genomic DNA. Translation: ABF99007.1.
AP008209 Genomic DNA. Translation: BAF13264.2. Sequence problems.
AK066083 mRNA. Translation: BAG89811.1.
AK102620 mRNA. Translation: BAG95642.1.
RefSeqNP_001051350.2. NM_001057885.2.
UniGeneOs.59314.

3D structure databases

ProteinModelPortalQ94H98.
ModBaseSearch...
MobiDBSearch...

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsOS03T0761100-01; OS03T0761100-01; OS03G0761100. [Q94H98-1]
OS03T0761100-03; OS03T0761100-03; OS03G0761100. [Q94H98-1]
GeneID4334191.
KEGGosa:4334191.

Organism-specific databases

GrameneQ94H98.

Phylogenomic databases

eggNOGCOG0631.
OMAAVARCCG.

Family and domain databases

Gene3D3.60.40.10. 1 hit.
InterProIPR001932. PP2C-like_dom.
IPR000222. PP2C_Mn2_Asp60_BS.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERPTHR13832. PTHR13832. 1 hit.
PfamPF00481. PP2C. 1 hit.
[Graphical view]
SMARTSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMSSF81606. SSF81606. 1 hit.
PROSITEPS01032. PP2C. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameP2C34_ORYSJ
AccessionPrimary (citable) accession number: Q94H98
Secondary accession number(s): Q10EH6, Q10EH8
Entry history
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: December 1, 2001
Last modified: May 14, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Oryza sativa (rice)

Index of Oryza sativa entries and their corresponding gene designations