Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q93Z24

- BGA17_ARATH

UniProt

Q93Z24 - BGA17_ARATH

Protein

Beta-galactosidase 17

Gene

BGAL17

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei218 – 2181Proton donorSequence Analysis
    Active sitei301 – 3011NucleophileSequence Analysis

    GO - Molecular functioni

    1. beta-galactosidase activity Source: UniProtKB-EC

    GO - Biological processi

    1. carbohydrate metabolic process Source: InterPro

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Enzyme and pathway databases

    BioCyciARA:AT1G72990-MONOMER.
    ARA:GQT-406-MONOMER.

    Protein family/group databases

    CAZyiGH35. Glycoside Hydrolase Family 35.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Beta-galactosidase 17 (EC:3.2.1.23)
    Short name:
    Lactase 17
    Gene namesi
    Name:BGAL17
    Ordered Locus Names:At1g72990
    ORF Names:F3N23.19
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 1

    Organism-specific databases

    TAIRiAT1G72990.

    Subcellular locationi

    GO - Cellular componenti

    1. apoplast Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Apoplast, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3535Sequence AnalysisAdd
    BLAST
    Chaini36 – 697662Beta-galactosidase 17PRO_0000293096Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi333 – 3331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi519 – 5191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi573 – 5731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi583 – 5831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi690 – 6901N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ93Z24.
    PRIDEiQ93Z24.

    Expressioni

    Tissue specificityi

    Ubiquitous, with higher expression levels in roots and siliques.2 Publications

    Gene expression databases

    GenevestigatoriQ93Z24.

    Structurei

    3D structure databases

    ProteinModelPortaliQ93Z24.
    SMRiQ93Z24. Positions 68-669.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 35 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG1874.
    HOGENOMiHOG000221607.
    InParanoidiQ93Z24.
    KOiK12309.
    OMAiRIPRVYW.
    PhylomeDBiQ93Z24.

    Family and domain databases

    Gene3Di2.60.120.260. 1 hit.
    3.20.20.80. 1 hit.
    InterProiIPR026283. B-gal_1-like.
    IPR008979. Galactose-bd-like.
    IPR019801. Glyco_hydro_35_CS.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR001944. Glycoside_Hdrlase_35.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view]
    PANTHERiPTHR23421. PTHR23421. 1 hit.
    PfamiPF01301. Glyco_hydro_35. 1 hit.
    [Graphical view]
    PIRSFiPIRSF006336. B-gal. 1 hit.
    PRINTSiPR00742. GLHYDRLASE35.
    SUPFAMiSSF49785. SSF49785. 2 hits.
    SSF51445. SSF51445. 1 hit.
    PROSITEiPS01182. GLYCOSYL_HYDROL_F35. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q93Z24-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAMTSWPSTG RQRRHQLASM LLLVLVVVGI YVPVFALLPS LSYTPQSLPS    50
    AIPQDEKMIS RKFYIKDDNF WKDGNRFQII GGDLHYFRVL PEYWEDRLLR 100
    ANALGLNTIQ VYVPWNLHEP KPGKMVFEGI GDLVSFLKLC EKLDFLVMLR 150
    AGPYICGEWD LGGFPAWLLA VKPRLQLRTS DPVYLKLVER WWDVLLPKVF 200
    PLLYSNGGPV IMVQIENEYG SYGNDKAYLR KLVSMARGHL GDDIIVYTTD 250
    GGTKETLDKG TVPVADVYSA VDFSTGDDPW PIFKLQKKFN APGRSPPLSS 300
    EFYTGWLTHW GEKITKTDAE FTAASLEKIL SRNGSAVLYM VHGGTNFGFY 350
    NGANTGSEES DYKPDLTSYD YDAPIKESGD IDNPKFQALQ RVIKKYNASP 400
    HPISPSNKQR KAYGSIKMQM TTSLFDLVRM TDPADVITSA NPISMESVGQ 450
    MFGFLLYESS YIAKKSGNTL RIPKVHDRAQ VFVSCLSQDV DVGVLRYIGT 500
    TERWNNQPIS LPTIECTTNT SLFILVENMG RVNYGPYIFD DKGILSSVYL 550
    DGQILHGWKM IPIPFHNLNQ EPNLTFEMQH TKNRSKKFEL TNDVGRKEPA 600
    LFAGEFSINS EEEIKDTYLS FNGWGKGVAF VNEFNIGRYW PSVGPQCNLY 650
    VPAPLLKRGK NTLVVFELES PHLELSLEAV DHQDFTCGSN VSKVNQL 697
    Length:697
    Mass (Da):78,640
    Last modified:December 1, 2001 - v1
    Checksum:i7A13124157BCE54A
    GO
    Isoform 2 (identifier: Q93Z24-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-92: MAMTSWPSTG...DLHYFRVLPE → MTISGKMGIVFRSLVVICITFVFFQRLWMQ

    Note: Derived from EST data. No experimental confirmation available.

    Show »
    Length:635
    Mass (Da):71,595
    Checksum:iCC8D3A972BAF5982
    GO

    Sequence cautioni

    The sequence AAD55646.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9292MAMTS…RVLPE → MTISGKMGIVFRSLVVICIT FVFFQRLWMQ in isoform 2. CuratedVSP_026468Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC008017 Genomic DNA. Translation: AAD55646.1. Sequence problems.
    CP002684 Genomic DNA. Translation: AEE35400.1.
    CP002684 Genomic DNA. Translation: AEE35401.1.
    AY058198 mRNA. Translation: AAL25611.1.
    AY142008 mRNA. Translation: AAM98272.1.
    PIRiC96755.
    RefSeqiNP_001031273.1. NM_001036196.1. [Q93Z24-2]
    NP_565051.1. NM_105957.2. [Q93Z24-1]
    UniGeneiAt.11678.

    Genome annotation databases

    EnsemblPlantsiAT1G72990.1; AT1G72990.1; AT1G72990. [Q93Z24-1]
    GeneIDi843630.
    KEGGiath:AT1G72990.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC008017 Genomic DNA. Translation: AAD55646.1 . Sequence problems.
    CP002684 Genomic DNA. Translation: AEE35400.1 .
    CP002684 Genomic DNA. Translation: AEE35401.1 .
    AY058198 mRNA. Translation: AAL25611.1 .
    AY142008 mRNA. Translation: AAM98272.1 .
    PIRi C96755.
    RefSeqi NP_001031273.1. NM_001036196.1. [Q93Z24-2 ]
    NP_565051.1. NM_105957.2. [Q93Z24-1 ]
    UniGenei At.11678.

    3D structure databases

    ProteinModelPortali Q93Z24.
    SMRi Q93Z24. Positions 68-669.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    CAZyi GH35. Glycoside Hydrolase Family 35.

    Proteomic databases

    PaxDbi Q93Z24.
    PRIDEi Q93Z24.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT1G72990.1 ; AT1G72990.1 ; AT1G72990 . [Q93Z24-1 ]
    GeneIDi 843630.
    KEGGi ath:AT1G72990.

    Organism-specific databases

    GeneFarmi 839. 90.
    TAIRi AT1G72990.

    Phylogenomic databases

    eggNOGi COG1874.
    HOGENOMi HOG000221607.
    InParanoidi Q93Z24.
    KOi K12309.
    OMAi RIPRVYW.
    PhylomeDBi Q93Z24.

    Enzyme and pathway databases

    BioCyci ARA:AT1G72990-MONOMER.
    ARA:GQT-406-MONOMER.

    Gene expression databases

    Genevestigatori Q93Z24.

    Family and domain databases

    Gene3Di 2.60.120.260. 1 hit.
    3.20.20.80. 1 hit.
    InterProi IPR026283. B-gal_1-like.
    IPR008979. Galactose-bd-like.
    IPR019801. Glyco_hydro_35_CS.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR001944. Glycoside_Hdrlase_35.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view ]
    PANTHERi PTHR23421. PTHR23421. 1 hit.
    Pfami PF01301. Glyco_hydro_35. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF006336. B-gal. 1 hit.
    PRINTSi PR00742. GLHYDRLASE35.
    SUPFAMi SSF49785. SSF49785. 2 hits.
    SSF51445. SSF51445. 1 hit.
    PROSITEi PS01182. GLYCOSYL_HYDROL_F35. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
      Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
      , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
      Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    4. "Apoplastic glycosidases active against xyloglucan oligosaccharides of Arabidopsis thaliana."
      Iglesias N., Abelenda J.A., Rodino M., Sampedro J., Revilla G., Zarra I.
      Plant Cell Physiol. 47:55-63(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    5. "Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 35."
      Ahn Y.O., Zheng M., Bevan D.R., Esen A., Shiu S.-H., Benson J., Peng H.-P., Miller J.T., Cheng C.-L., Poulton J.E., Shih M.-C.
      Phytochemistry 68:1510-1520(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, GENE FAMILY, NOMENCLATURE.

    Entry informationi

    Entry nameiBGA17_ARATH
    AccessioniPrimary (citable) accession number: Q93Z24
    Secondary accession number(s): Q2V4C9, Q9SSM8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3