Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q93Z24

- BGA17_ARATH

UniProt

Q93Z24 - BGA17_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Beta-galactosidase 17

Gene

BGAL17

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei218 – 2181Proton donorSequence Analysis
Active sitei301 – 3011NucleophileSequence Analysis

GO - Molecular functioni

  1. beta-galactosidase activity Source: UniProtKB-EC

GO - Biological processi

  1. carbohydrate metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

BioCyciARA:AT1G72990-MONOMER.
ARA:GQT-406-MONOMER.
ReactomeiREACT_187644. HS-GAG degradation.
REACT_187659. Glycosphingolipid metabolism.
REACT_187663. Keratan sulfate degradation.

Protein family/group databases

CAZyiGH35. Glycoside Hydrolase Family 35.

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-galactosidase 17 (EC:3.2.1.23)
Short name:
Lactase 17
Gene namesi
Name:BGAL17
Ordered Locus Names:At1g72990
ORF Names:F3N23.19
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 1

Organism-specific databases

TAIRiAT1G72990.

Subcellular locationi

GO - Cellular componenti

  1. apoplast Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Apoplast, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence AnalysisAdd
BLAST
Chaini36 – 697662Beta-galactosidase 17PRO_0000293096Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi333 – 3331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi519 – 5191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi573 – 5731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi583 – 5831N-linked (GlcNAc...)Sequence Analysis
Glycosylationi690 – 6901N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ93Z24.
PRIDEiQ93Z24.

Expressioni

Tissue specificityi

Ubiquitous, with higher expression levels in roots and siliques.2 Publications

Gene expression databases

GenevestigatoriQ93Z24.

Structurei

3D structure databases

ProteinModelPortaliQ93Z24.
SMRiQ93Z24. Positions 68-669.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 35 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1874.
HOGENOMiHOG000221607.
InParanoidiQ93Z24.
KOiK12309.
OMAiRIPRVYW.
PhylomeDBiQ93Z24.

Family and domain databases

Gene3Di2.60.120.260. 1 hit.
3.20.20.80. 1 hit.
InterProiIPR026283. B-gal_1-like.
IPR008979. Galactose-bd-like.
IPR019801. Glyco_hydro_35_CS.
IPR013781. Glyco_hydro_catalytic_dom.
IPR001944. Glycoside_Hdrlase_35.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PANTHERiPTHR23421. PTHR23421. 1 hit.
PfamiPF01301. Glyco_hydro_35. 1 hit.
[Graphical view]
PIRSFiPIRSF006336. B-gal. 1 hit.
PRINTSiPR00742. GLHYDRLASE35.
SUPFAMiSSF49785. SSF49785. 2 hits.
SSF51445. SSF51445. 1 hit.
PROSITEiPS01182. GLYCOSYL_HYDROL_F35. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q93Z24-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMTSWPSTG RQRRHQLASM LLLVLVVVGI YVPVFALLPS LSYTPQSLPS
60 70 80 90 100
AIPQDEKMIS RKFYIKDDNF WKDGNRFQII GGDLHYFRVL PEYWEDRLLR
110 120 130 140 150
ANALGLNTIQ VYVPWNLHEP KPGKMVFEGI GDLVSFLKLC EKLDFLVMLR
160 170 180 190 200
AGPYICGEWD LGGFPAWLLA VKPRLQLRTS DPVYLKLVER WWDVLLPKVF
210 220 230 240 250
PLLYSNGGPV IMVQIENEYG SYGNDKAYLR KLVSMARGHL GDDIIVYTTD
260 270 280 290 300
GGTKETLDKG TVPVADVYSA VDFSTGDDPW PIFKLQKKFN APGRSPPLSS
310 320 330 340 350
EFYTGWLTHW GEKITKTDAE FTAASLEKIL SRNGSAVLYM VHGGTNFGFY
360 370 380 390 400
NGANTGSEES DYKPDLTSYD YDAPIKESGD IDNPKFQALQ RVIKKYNASP
410 420 430 440 450
HPISPSNKQR KAYGSIKMQM TTSLFDLVRM TDPADVITSA NPISMESVGQ
460 470 480 490 500
MFGFLLYESS YIAKKSGNTL RIPKVHDRAQ VFVSCLSQDV DVGVLRYIGT
510 520 530 540 550
TERWNNQPIS LPTIECTTNT SLFILVENMG RVNYGPYIFD DKGILSSVYL
560 570 580 590 600
DGQILHGWKM IPIPFHNLNQ EPNLTFEMQH TKNRSKKFEL TNDVGRKEPA
610 620 630 640 650
LFAGEFSINS EEEIKDTYLS FNGWGKGVAF VNEFNIGRYW PSVGPQCNLY
660 670 680 690
VPAPLLKRGK NTLVVFELES PHLELSLEAV DHQDFTCGSN VSKVNQL
Length:697
Mass (Da):78,640
Last modified:December 1, 2001 - v1
Checksum:i7A13124157BCE54A
GO
Isoform 2 (identifier: Q93Z24-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MAMTSWPSTG...DLHYFRVLPE → MTISGKMGIVFRSLVVICITFVFFQRLWMQ

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:635
Mass (Da):71,595
Checksum:iCC8D3A972BAF5982
GO

Sequence cautioni

The sequence AAD55646.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9292MAMTS…RVLPE → MTISGKMGIVFRSLVVICIT FVFFQRLWMQ in isoform 2. CuratedVSP_026468Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC008017 Genomic DNA. Translation: AAD55646.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE35400.1.
CP002684 Genomic DNA. Translation: AEE35401.1.
AY058198 mRNA. Translation: AAL25611.1.
AY142008 mRNA. Translation: AAM98272.1.
PIRiC96755.
RefSeqiNP_001031273.1. NM_001036196.1. [Q93Z24-2]
NP_565051.1. NM_105957.2. [Q93Z24-1]
UniGeneiAt.11678.

Genome annotation databases

EnsemblPlantsiAT1G72990.1; AT1G72990.1; AT1G72990. [Q93Z24-1]
GeneIDi843630.
KEGGiath:AT1G72990.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC008017 Genomic DNA. Translation: AAD55646.1 . Sequence problems.
CP002684 Genomic DNA. Translation: AEE35400.1 .
CP002684 Genomic DNA. Translation: AEE35401.1 .
AY058198 mRNA. Translation: AAL25611.1 .
AY142008 mRNA. Translation: AAM98272.1 .
PIRi C96755.
RefSeqi NP_001031273.1. NM_001036196.1. [Q93Z24-2 ]
NP_565051.1. NM_105957.2. [Q93Z24-1 ]
UniGenei At.11678.

3D structure databases

ProteinModelPortali Q93Z24.
SMRi Q93Z24. Positions 68-669.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

CAZyi GH35. Glycoside Hydrolase Family 35.

Proteomic databases

PaxDbi Q93Z24.
PRIDEi Q93Z24.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT1G72990.1 ; AT1G72990.1 ; AT1G72990 . [Q93Z24-1 ]
GeneIDi 843630.
KEGGi ath:AT1G72990.

Organism-specific databases

GeneFarmi 839. 90.
TAIRi AT1G72990.

Phylogenomic databases

eggNOGi COG1874.
HOGENOMi HOG000221607.
InParanoidi Q93Z24.
KOi K12309.
OMAi RIPRVYW.
PhylomeDBi Q93Z24.

Enzyme and pathway databases

BioCyci ARA:AT1G72990-MONOMER.
ARA:GQT-406-MONOMER.
Reactomei REACT_187644. HS-GAG degradation.
REACT_187659. Glycosphingolipid metabolism.
REACT_187663. Keratan sulfate degradation.

Gene expression databases

Genevestigatori Q93Z24.

Family and domain databases

Gene3Di 2.60.120.260. 1 hit.
3.20.20.80. 1 hit.
InterProi IPR026283. B-gal_1-like.
IPR008979. Galactose-bd-like.
IPR019801. Glyco_hydro_35_CS.
IPR013781. Glyco_hydro_catalytic_dom.
IPR001944. Glycoside_Hdrlase_35.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view ]
PANTHERi PTHR23421. PTHR23421. 1 hit.
Pfami PF01301. Glyco_hydro_35. 1 hit.
[Graphical view ]
PIRSFi PIRSF006336. B-gal. 1 hit.
PRINTSi PR00742. GLHYDRLASE35.
SUPFAMi SSF49785. SSF49785. 2 hits.
SSF51445. SSF51445. 1 hit.
PROSITEi PS01182. GLYCOSYL_HYDROL_F35. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
    Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
    , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
    Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  4. "Apoplastic glycosidases active against xyloglucan oligosaccharides of Arabidopsis thaliana."
    Iglesias N., Abelenda J.A., Rodino M., Sampedro J., Revilla G., Zarra I.
    Plant Cell Physiol. 47:55-63(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  5. "Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 35."
    Ahn Y.O., Zheng M., Bevan D.R., Esen A., Shiu S.-H., Benson J., Peng H.-P., Miller J.T., Cheng C.-L., Poulton J.E., Shih M.-C.
    Phytochemistry 68:1510-1520(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, GENE FAMILY, NOMENCLATURE.

Entry informationi

Entry nameiBGA17_ARATH
AccessioniPrimary (citable) accession number: Q93Z24
Secondary accession number(s): Q2V4C9, Q9SSM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: December 1, 2001
Last modified: November 26, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3