Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q93Z24 (BGA17_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Beta-galactosidase 17

Short name=Lactase 17
EC=3.2.1.23
Gene names
Name:BGAL17
Ordered Locus Names:At1g72990
ORF Names:F3N23.19
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length697 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.

Subcellular location

Secretedextracellular spaceapoplast Potential.

Tissue specificity

Ubiquitous, with higher expression levels in roots and siliques. Ref.4 Ref.5

Sequence similarities

Belongs to the glycosyl hydrolase 35 family.

Sequence caution

The sequence AAD55646.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Cellular componentApoplast
Secreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionGlycosidase
Hydrolase
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcarbohydrate metabolic process

Inferred from electronic annotation. Source: InterPro

   Cellular_componentapoplast

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionbeta-galactosidase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q93Z24-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q93Z24-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MAMTSWPSTG...DLHYFRVLPE → MTISGKMGIVFRSLVVICITFVFFQRLWMQ
Note: Derived from EST data. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3535 Potential
Chain36 – 697662Beta-galactosidase 17
PRO_0000293096

Sites

Active site2181Proton donor Potential
Active site3011Nucleophile Potential

Amino acid modifications

Glycosylation3331N-linked (GlcNAc...) Potential
Glycosylation5191N-linked (GlcNAc...) Potential
Glycosylation5731N-linked (GlcNAc...) Potential
Glycosylation5831N-linked (GlcNAc...) Potential
Glycosylation6901N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 9292MAMTS…RVLPE → MTISGKMGIVFRSLVVICIT FVFFQRLWMQ in isoform 2.
VSP_026468

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 7A13124157BCE54A

FASTA69778,640
        10         20         30         40         50         60 
MAMTSWPSTG RQRRHQLASM LLLVLVVVGI YVPVFALLPS LSYTPQSLPS AIPQDEKMIS 

        70         80         90        100        110        120 
RKFYIKDDNF WKDGNRFQII GGDLHYFRVL PEYWEDRLLR ANALGLNTIQ VYVPWNLHEP 

       130        140        150        160        170        180 
KPGKMVFEGI GDLVSFLKLC EKLDFLVMLR AGPYICGEWD LGGFPAWLLA VKPRLQLRTS 

       190        200        210        220        230        240 
DPVYLKLVER WWDVLLPKVF PLLYSNGGPV IMVQIENEYG SYGNDKAYLR KLVSMARGHL 

       250        260        270        280        290        300 
GDDIIVYTTD GGTKETLDKG TVPVADVYSA VDFSTGDDPW PIFKLQKKFN APGRSPPLSS 

       310        320        330        340        350        360 
EFYTGWLTHW GEKITKTDAE FTAASLEKIL SRNGSAVLYM VHGGTNFGFY NGANTGSEES 

       370        380        390        400        410        420 
DYKPDLTSYD YDAPIKESGD IDNPKFQALQ RVIKKYNASP HPISPSNKQR KAYGSIKMQM 

       430        440        450        460        470        480 
TTSLFDLVRM TDPADVITSA NPISMESVGQ MFGFLLYESS YIAKKSGNTL RIPKVHDRAQ 

       490        500        510        520        530        540 
VFVSCLSQDV DVGVLRYIGT TERWNNQPIS LPTIECTTNT SLFILVENMG RVNYGPYIFD 

       550        560        570        580        590        600 
DKGILSSVYL DGQILHGWKM IPIPFHNLNQ EPNLTFEMQH TKNRSKKFEL TNDVGRKEPA 

       610        620        630        640        650        660 
LFAGEFSINS EEEIKDTYLS FNGWGKGVAF VNEFNIGRYW PSVGPQCNLY VPAPLLKRGK 

       670        680        690 
NTLVVFELES PHLELSLEAV DHQDFTCGSN VSKVNQL 

« Hide

Isoform 2 [UniParc].

Checksum: CC8D3A972BAF5982
Show »

FASTA63571,595

References

« Hide 'large scale' references
[1]"Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. expand/collapse author list , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[2]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[3]"Empirical analysis of transcriptional activity in the Arabidopsis genome."
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. expand/collapse author list , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: cv. Columbia.
[4]"Apoplastic glycosidases active against xyloglucan oligosaccharides of Arabidopsis thaliana."
Iglesias N., Abelenda J.A., Rodino M., Sampedro J., Revilla G., Zarra I.
Plant Cell Physiol. 47:55-63(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[5]"Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 35."
Ahn Y.O., Zheng M., Bevan D.R., Esen A., Shiu S.-H., Benson J., Peng H.-P., Miller J.T., Cheng C.-L., Poulton J.E., Shih M.-C.
Phytochemistry 68:1510-1520(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, GENE FAMILY, NOMENCLATURE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC008017 Genomic DNA. Translation: AAD55646.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE35400.1.
CP002684 Genomic DNA. Translation: AEE35401.1.
AY058198 mRNA. Translation: AAL25611.1.
AY142008 mRNA. Translation: AAM98272.1.
PIRC96755.
RefSeqNP_001031273.1. NM_001036196.1. [Q93Z24-2]
NP_565051.1. NM_105957.2. [Q93Z24-1]
UniGeneAt.11678.

3D structure databases

ProteinModelPortalQ93Z24.
SMRQ93Z24. Positions 68-669.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

CAZyGH35. Glycoside Hydrolase Family 35.

Proteomic databases

PaxDbQ93Z24.
PRIDEQ93Z24.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT1G72990.1; AT1G72990.1; AT1G72990. [Q93Z24-1]
GeneID843630.
KEGGath:AT1G72990.

Organism-specific databases

GeneFarm839. 90.
TAIRAT1G72990.

Phylogenomic databases

eggNOGCOG1874.
HOGENOMHOG000221607.
InParanoidQ93Z24.
KOK12309.
OMARIPRVYW.
PhylomeDBQ93Z24.

Enzyme and pathway databases

BioCycARA:AT1G72990-MONOMER.
ARA:GQT-406-MONOMER.

Gene expression databases

GenevestigatorQ93Z24.

Family and domain databases

Gene3D2.60.120.260. 1 hit.
3.20.20.80. 1 hit.
InterProIPR026283. B-gal_1-like.
IPR008979. Galactose-bd-like.
IPR019801. Glyco_hydro_35_CS.
IPR013781. Glyco_hydro_catalytic_dom.
IPR001944. Glycoside_Hdrlase_35.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PANTHERPTHR23421. PTHR23421. 1 hit.
PfamPF01301. Glyco_hydro_35. 1 hit.
[Graphical view]
PIRSFPIRSF006336. B-gal. 1 hit.
PRINTSPR00742. GLHYDRLASE35.
SUPFAMSSF49785. SSF49785. 2 hits.
SSF51445. SSF51445. 1 hit.
PROSITEPS01182. GLYCOSYL_HYDROL_F35. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameBGA17_ARATH
AccessionPrimary (citable) accession number: Q93Z24
Secondary accession number(s): Q2V4C9, Q9SSM8
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: December 1, 2001
Last modified: May 14, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Glycosyl hydrolases

Classification of glycosyl hydrolase families and list of entries

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names