Reviewed,
UniProtKB/Swiss-Prot Q93084 (AT2A3_HUMAN)
Last modified
October 13, 2009.
Version 101.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=SERCA3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 SR Ca(2+)-ATPase 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1043 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. |
| Catalytic activity | ATP + H2O + Ca2+(Cis) = ADP + phosphate + Ca2+(Trans). |
| Subcellular location | Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) family. Type IIA subfamily. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NCK1 | P16333 | 1 | EBI-1046185,EBI-389883 | |
| WDR8 | Q9P2S5 | 1 | EBI-1046185,EBI-1054904 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: The same names have been attributed to different isoforms. | ||||||
| Isoform SERCA3B (identifier: Q93084-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: Q93084-2) Also known as: HuS3-II; The sequence of this isoform differs from the canonical sequence as follows: 994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK | ||||||
| Isoform SERCA3C (identifier: Q93084-3) Also known as: HuS3-IV; The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK | ||||||
| Isoform SERCA3D (identifier: Q93084-4) Also known as: HuS3-I; The sequence of this isoform differs from the canonical sequence as follows: 994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK | ||||||
| Isoform SERCA3E (identifier: Q93084-5) The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREE | ||||||
| Isoform SERCA3F (identifier: Q93084-6) The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1043 | 1043 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046202 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | 1 By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | 2 By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | 3 By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | 4 By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | 5 By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | 6 By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | 7 By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | 8 By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | 9 By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | 10 By similarity | ||||||
| Topological domain | 986 – 1043 | 58 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.6 Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1043 | 50 | ACLYP…VCTSD → EEMSQK in isoform SERCA3A. | VSP_000364 | |||||
| Alternative sequence | 994 – 1043 | 50 | ACLYP…VCTSD → EMSQK in isoform SERCA3D. | VSP_000365 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → LASLKK in isoform SERCA3C. | VSP_000366 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREE in isoform SERCA3E. | VSP_000367 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK in isoform SERCA3F. | VSP_000368 | |||||
| Natural variant | 674 | 1 | R → H in a breast cancer sample; somatic mutation. Ref.10 | VAR_036498 | |||||
| Natural variant | 869 | 1 | Q → H: dbSNP rs11654827. | VAR_048372 | |||||
Experimental info | |||||||||
| Sequence conflict | 673 | 1 | A → T in AAC24525. Ref.4 | ||||||
| Sequence conflict | 802 | 1 | L → H in CAA75739. Ref.3 | ||||||
| Sequence conflict | 817 | 1 | M → I in CAA93737. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene." Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R. Biochem. J. 318:689-699(1996) [PubMed: 8809064] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A). Tissue: Leukemic T-cell. |
| [2] | Erratum Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R. Biochem. J. 319:1008-1008(1996) |
| [3] | "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA." Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F. J. Biol. Chem. 273:13982-13994(1998) [PubMed: 9593748] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C). |
| [4] | "Functional characterization of alternatively spliced human SERCA3 transcripts." Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J. Am. J. Physiol. 275:C1449-C1458(1998) [PubMed: 9843705] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3D). Tissue: Kidney and Leukemic T-cell. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A). Tissue: Ovary. |
| [6] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed: 12665801] [Abstract] Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1. Tissue: Platelet. |
| [7] | Bienvenut W.V., Claeys D. Submitted (NOV-2005) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, MASS SPECTROMETRY. Tissue: Platelet. |
| [8] | "A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells." Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R. J. Biol. Chem. 269:1410-1416(1994) [PubMed: 8288608] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509. |
| [9] | "Splicing of sarco/endoplasmic reticulum Ca2+ ATPase 3 genes generates multiple and species-specific variants of Ca2+ transporting pumps." Martin V., Bredoux R., Corvazier E., van Gorp R., Kovacs T., Gelebart P., Papp B., Enouf J. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3E AND SERCA3F). |
| [10] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Z69881 mRNA. Translation: CAA93737.1. Z69880 Genomic DNA. Translation: CAA93736.1. Y15724 Y15730 Genomic DNA. Translation: CAA75739.1. Y15738 Genomic DNA. Translation: CAA75748.1. Y15737 Genomic DNA. Translation: CAA75747.1. AF068220 mRNA. Translation: AAC24525.1. AF068221 mRNA. Translation: AAC24526.1. BC035729 mRNA. Translation: AAH35729.1. S68239 mRNA. Translation: AAB29700.1. AF458228 mRNA. Translation: AAL78967.1. AF458229 mRNA. Translation: AAL78968.1. | |
| IPI | IPI00004092. IPI00218440. IPI00218442. IPI00303760. IPI00478023. IPI00748794. |
| PIR | I55399. S72267. |
| RefSeq | NP_005164.2. NP_777613.1. NP_777614.1. NP_777615.1. NP_777616.1. NP_777617.1. NP_777618.1. |
| UniGene | Hs.513870 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1EUL based on UniProtKB P04191. |
| SMR | Q93084. Positions 1-994. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q93084. 6 interactions. |
| STRING | Q93084. |
PTM databases | |
| PhosphoSite | Q93084. |
Proteomic databases | |
| PRIDE | Q93084. |
Genome annotation databases | |
| Ensembl | ENST00000309890; ENSP00000312577; ENSG00000074370; Homo sapiens. [Genome view] ENST00000352011; ENSP00000301387; ENSG00000074370; Homo sapiens. [Genome view] ENST00000359983; ENSP00000353072; ENSG00000074370; Homo sapiens. [Genome view] ENST00000397035; ENSP00000380229; ENSG00000074370; Homo sapiens. [Genome view] ENST00000397039; ENSP00000380232; ENSG00000074370; Homo sapiens. [Genome view] ENST00000397041; ENSP00000380234; ENSG00000074370; Homo sapiens. [Genome view] ENST00000397043; ENSP00000380236; ENSG00000074370; Homo sapiens. [Genome view] ENST00000397045; ENSP00000380238; ENSG00000074370; Homo sapiens. [Genome view] |
| GeneID | 489. |
| KEGG | hsa:489. |
| UCSC | uc002fwx.1. human. uc002fwy.1. human. uc002fwz.1. human. uc002fxb.1. human. uc002fxc.1. human. uc002fxd.1. human. |
Organism-specific databases | |
| CTD | 489. |
| GeneCards | GC17M003761. |
| H-InvDB | HIX0027123. |
| HGNC | HGNC:813. ATP2A3. |
| HPA | CAB010882. HPA007180. |
| MIM | 601929. gene. |
| PharmGKB | PA25106. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q93084. |
Enzyme and pathway databases | |
| BRENDA | 3.6.3.8. 247. |
Gene expression databases | |
| ArrayExpress | Q93084. |
| Bgee | Q93084. |
| CleanEx | HS_ATP2A3. |
| Genevestigator | Q93084. |
| GermOnline | ENSG00000074370. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008250. ATPase_P-typ_ATPase-assoc-reg. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR005834. Dehalogen-like_hydro. [Graphical view] |
| PANTHER | PTHR11939. ATPase_P. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 4 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 2037. |
| SOURCE | Search... |
Entry information
| Entry name | AT2A3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93084 Secondary accession number(s): O60900 Q8TEX6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


