Q93084 (AT2A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=SERCA3 Short name=SR Ca(2+)-ATPase 3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1043 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Ref.11 Ref.12 |
| Catalytic activity | ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2). |
| Subcellular location | Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein Ref.12. |
| Tissue specificity | Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. Ref.11 Ref.12 |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: The same names have been attributed to different isoforms. | ||||||
| Isoform SERCA3B (identifier: Q93084-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: Q93084-2) Also known as: HuS3-II; The sequence of this isoform differs from the canonical sequence as follows: 994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK | ||||||
| Isoform SERCA3C (identifier: Q93084-3) Also known as: HuS3-IV; The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK | ||||||
| Isoform SERCA3G (identifier: Q93084-4) Also known as: HuS3-I; The sequence of this isoform differs from the canonical sequence as follows: 994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK | ||||||
| Isoform SERCA3E (identifier: Q93084-5) The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK | ||||||
| Isoform SERCA3D (identifier: Q93084-6) The sequence of this isoform differs from the canonical sequence as follows: 1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK | ||||||
| Isoform SERCA3F (identifier: Q93084-7) The sequence of this isoform differs from the canonical sequence as follows: 994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1043 | 1043 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046202 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 986 – 1043 | 58 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.8 Ref.9 | ||||||
| Modified residue | 662 | 1 | Phosphoserine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1043 | 50 | ACLYP…VCTSD → EEMSQK in isoform SERCA3A. | VSP_000364 | |||||
| Alternative sequence | 994 – 1043 | 50 | ACLYP…VCTSD → EMSQK in isoform SERCA3G. | VSP_000365 | |||||
| Alternative sequence | 994 – 1022 | 29 | ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F. | VSP_042296 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → LASLKK in isoform SERCA3C. | VSP_000366 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D. | VSP_000368 | |||||
| Alternative sequence | 1024 – 1043 | 20 | RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E. | VSP_000367 | |||||
| Natural variant | 674 | 1 | R → H in a breast cancer sample; somatic mutation. Ref.15 | VAR_036498 | |||||
| Natural variant | 869 | 1 | Q → H. Corresponds to variant rs11654827 [ dbSNP | Ensembl ]. | VAR_048372 | |||||
Experimental info | |||||||||
| Sequence conflict | 673 | 1 | A → T in AAC24525. Ref.4 | ||||||
| Sequence conflict | 802 | 1 | L → H in CAA75739. Ref.3 | ||||||
| Sequence conflict | 817 | 1 | M → I in CAA93737. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene." Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R. Biochem. J. 318:689-699(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A). Tissue: Leukemic T-cell. |
| [2] | Erratum Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R. Biochem. J. 319:1008-1008(1996) |
| [3] | "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA." Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F. J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C). |
| [4] | "Functional characterization of alternatively spliced human SERCA3 transcripts." Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J. Am. J. Physiol. 275:C1449-C1458(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3G). Tissue: Kidney and Leukemic T-cell. |
| [5] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A). Tissue: Ovary. |
| [8] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1. Tissue: Platelet. |
| [9] | Bienvenut W.V., Claeys D. Submitted (NOV-2005) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, MASS SPECTROMETRY. Tissue: Platelet. |
| [10] | "A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells." Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R. J. Biol. Chem. 269:1410-1416(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509. |
| [11] | "Three novel sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) 3 isoforms. Expression, regulation, and function of the membranes of the SERCA3 family." Martin V., Bredoux R., Corvazier E., Van Gorp R., Kovacs T., Gelebart P., Enouf J. J. Biol. Chem. 277:24442-24452(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3D AND SERCA3E), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY. |
| [12] | "Identification, expression, function, and localization of a novel (sixth) isoform of the human sarco/endoplasmic reticulum Ca2+ATPase 3 gene." Bobe R., Bredoux R., Corvazier E., Andersen J.P., Clausen J.D., Dode L., Kovacs T., Enouf J. J. Biol. Chem. 279:24297-24306(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORM SERCA3F), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-662, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z69881 mRNA. Translation: CAA93737.1. Z69880 Genomic DNA. Translation: CAA93736.1. Y15724 Y15730 Genomic DNA. Translation: CAA75739.1.Y15738 Genomic DNA. Translation: CAA75748.1. Y15737 Genomic DNA. Translation: CAA75747.1. AF068220 mRNA. Translation: AAC24525.1. AF068221 mRNA. Translation: AAC24526.1. AC005940 Genomic DNA. No translation available. CH471108 Genomic DNA. Translation: EAW90468.1. CH471108 Genomic DNA. Translation: EAW90463.1. CH471108 Genomic DNA. Translation: EAW90469.1. BC035729 mRNA. Translation: AAH35729.1. S68239 mRNA. Translation: AAB29700.1. AF458228 mRNA. Translation: AAL78967.1. AF458229 mRNA. Translation: AAL78968.1. AY460339 mRNA. Translation: AAR15415.1. |
| IPI | IPI00004092. IPI00218440. IPI00303760. IPI00478023. IPI00748794. IPI00871568. IPI01010541. |
| PIR | I55399. S72267. |
| RefSeq | NP_005164.2. NM_005173.3. NP_777613.1. NM_174953.2. NP_777614.1. NM_174954.2. NP_777615.1. NM_174955.2. NP_777616.1. NM_174956.2. NP_777617.1. NM_174957.2. NP_777618.1. NM_174958.2. |
| UniGene | Hs.513870. |
3D structure databases | |
| ProteinModelPortal | Q93084. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q93084. 4 interactions. |
| STRING | 9606.ENSP00000353072. |
PTM databases | |
| PhosphoSite | Q93084. |
Polymorphism databases | |
| DMDM | 19864659. |
Proteomic databases | |
| PaxDb | Q93084. |
| PRIDE | Q93084. |
Protocols and materials databases | |
| DNASU | 489. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000309890; ENSP00000312577; ENSG00000074370. ENST00000352011; ENSP00000301387; ENSG00000074370. ENST00000359983; ENSP00000353072; ENSG00000074370. ENST00000397035; ENSP00000380229; ENSG00000074370. ENST00000397041; ENSP00000380234; ENSG00000074370. ENST00000397043; ENSP00000380236; ENSG00000074370. ENST00000570845; ENSP00000461480; ENSG00000074370. ENST00000572116; ENSP00000458865; ENSG00000074370. |
| GeneID | 489. |
| KEGG | hsa:489. |
| UCSC | uc002fwx.2. human. uc002fwy.2. human. uc002fwz.2. human. uc002fxb.2. human. uc002fxc.2. human. uc002fxd.2. human. |
Organism-specific databases | |
| CTD | 489. |
| GeneCards | GC17M003822. |
| HGNC | HGNC:813. ATP2A3. |
| HPA | CAB010882. HPA007180. |
| MIM | 601929. gene. |
| neXtProt | NX_Q93084. |
| PharmGKB | PA25106. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0474. |
| HOGENOM | HOG000078632. |
| HOVERGEN | HBG105648. |
| KO | K05853. |
| OMA | GAGAMYH. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | Q93084. |
| Bgee | Q93084. |
| CleanEx | HS_ATP2A3. |
| Genevestigator | Q93084. |
| GermOnline | ENSG00000074370. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.1110.10. 2 hits. 2.70.150.10. 2 hits. 3.40.1110.10. 1 hit. |
| InterPro | IPR005782. ATPase_P-typ_Ca-transp_IIA. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023299. ATPase_P-typ_cyto_domN. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] |
| PANTHER | PTHR24093. PTHR24093. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL2401. |
| GenomeRNAi | 489. |
| NextBio | 2037. |
| SOURCE | Search... |
Entry information
| Entry name | AT2A3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93084 Secondary accession number(s): A8MZG0 Q8TEX6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
