Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

ATP2A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.2 Publications

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Binding sitei515 – 5151ATPBy similarity
Metal bindingi703 – 7031MagnesiumBy similarity
Metal bindingi707 – 7071MagnesiumBy similarity
Metal bindingi768 – 7681Calcium 1By similarity
Metal bindingi771 – 7711Calcium 1By similarity
Metal bindingi796 – 7961Calcium 2By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi800 – 8001Calcium 1By similarity
Metal bindingi800 – 8001Calcium 2By similarity
Metal bindingi908 – 9081Calcium 1By similarity

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • calcium-transporting ATPase activity Source: ProtInc
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • blood coagulation Source: Reactome
  • calcium ion transport Source: UniProtKB
  • ion transmembrane transport Source: Reactome
  • transmembrane transport Source: Reactome
  • transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_118798. Pre-NOTCH Processing in Golgi.
REACT_23765. Reduction of cytosolic Ca++ levels.
REACT_25149. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:ATP2A3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:813. ATP2A3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Topological domaini314 – 757444CytoplasmicBy similarityAdd
BLAST
Transmembranei758 – 77720Helical; Name=5By similarityAdd
BLAST
Topological domaini778 – 78710LumenalBy similarity
Transmembranei788 – 80821Helical; Name=6By similarityAdd
BLAST
Topological domaini809 – 82820CytoplasmicBy similarityAdd
BLAST
Transmembranei829 – 85123Helical; Name=7By similarityAdd
BLAST
Topological domaini852 – 89746LumenalBy similarityAdd
BLAST
Transmembranei898 – 91720Helical; Name=8By similarityAdd
BLAST
Topological domaini918 – 93013CytoplasmicBy similarityAdd
BLAST
Transmembranei931 – 94919Helical; Name=9By similarityAdd
BLAST
Topological domaini950 – 96415LumenalBy similarityAdd
BLAST
Transmembranei965 – 98521Helical; Name=10By similarityAdd
BLAST
Topological domaini986 – 104358CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25106.

Polymorphism and mutation databases

BioMutaiATP2A3.
DMDMi19864659.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046202Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications
Modified residuei662 – 6621Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93084.
PaxDbiQ93084.
PRIDEiQ93084.

PTM databases

PhosphoSiteiQ93084.

Expressioni

Tissue specificityi

Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines.2 Publications

Gene expression databases

BgeeiQ93084.
CleanExiHS_ATP2A3.
GenevisibleiQ93084. HS.

Organism-specific databases

HPAiCAB010882.
HPA007180.

Interactioni

Protein-protein interaction databases

BioGridi106979. 25 interactions.
IntActiQ93084. 6 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ93084.
SMRiQ93084. Positions 1-992.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00760000119003.
HOGENOMiHOG000078632.
HOVERGENiHBG105648.
InParanoidiQ93084.
KOiK05853.
OMAiQREVAIE.
OrthoDBiEOG73Z2SF.
PhylomeDBiQ93084.
TreeFamiTF300651.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF280. PTHR24093:SF280. 1 hit.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: The same names have been attributed to different isoforms.

Isoform SERCA3B (identifier: Q93084-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW
60 70 80 90 100
ELVLEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TEAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT SREQILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYSNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHACLYPGL
1010 1020 1030 1040
LRTVSQAWSR QPLTTSWTPD HTGRNEPEVS AGNRVESPVC TSD
Length:1,043
Mass (Da):113,977
Last modified:October 18, 2001 - v2
Checksum:iCB6514B36E00E091
GO
Isoform SERCA3A (identifier: Q93084-2) [UniParc]FASTAAdd to basket

Also known as: HuS3-II

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK

Show »
Length:999
Mass (Da):109,256
Checksum:i44E9F1FBF41FE36A
GO
Isoform SERCA3C (identifier: Q93084-3) [UniParc]FASTAAdd to basket

Also known as: HuS3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK

Show »
Length:1,029
Mass (Da):112,490
Checksum:iF92E6B85AC5BBB81
GO
Isoform SERCA3G (identifier: Q93084-4) [UniParc]FASTAAdd to basket

Also known as: HuS3-I

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK

Show »
Length:998
Mass (Da):109,127
Checksum:i5C1288D99FE36A3D
GO
Isoform SERCA3E (identifier: Q93084-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK

Show »
Length:1,052
Mass (Da):114,931
Checksum:i95DCA1787DEDE2B9
GO
Isoform SERCA3D (identifier: Q93084-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK

Show »
Length:1,044
Mass (Da):114,131
Checksum:i2D26449A0E4EDC9A
GO
Isoform SERCA3F (identifier: Q93084-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ

Show »
Length:1,033
Mass (Da):112,778
Checksum:i02356BCFB8CDA61F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti673 – 6731A → T in AAC24525 (PubMed:9843705).Curated
Sequence conflicti802 – 8021L → H in CAA75739 (PubMed:9593748).Curated
Sequence conflicti817 – 8171M → I in CAA93737 (PubMed:8809064).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti674 – 6741R → H in a breast cancer sample; somatic mutation. 1 Publication
VAR_036498
Natural varianti869 – 8691Q → H.
Corresponds to variant rs11654827 [ dbSNP | Ensembl ].
VAR_048372

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 104350ACLYP…VCTSD → EEMSQK in isoform SERCA3A. 3 PublicationsVSP_000364Add
BLAST
Alternative sequencei994 – 104350ACLYP…VCTSD → EMSQK in isoform SERCA3G. 1 PublicationVSP_000365Add
BLAST
Alternative sequencei994 – 102229ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F. 1 PublicationVSP_042296Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLKK in isoform SERCA3C. 1 PublicationVSP_000366Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D. 1 PublicationVSP_000368Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E. 1 PublicationVSP_000367Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724
, Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSiCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRiI55399.
S72267.
RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneiHs.513870.

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
GeneIDi489.
KEGGihsa:489.
UCSCiuc002fwx.2. human. [Q93084-3]
uc002fwy.2. human. [Q93084-5]
uc002fwz.2. human. [Q93084-6]
uc002fxb.2. human. [Q93084-1]
uc002fxc.2. human. [Q93084-2]
uc002fxd.2. human. [Q93084-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724
, Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSiCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRiI55399.
S72267.
RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneiHs.513870.

3D structure databases

ProteinModelPortaliQ93084.
SMRiQ93084. Positions 1-992.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106979. 25 interactions.
IntActiQ93084. 6 interactions.

PTM databases

PhosphoSiteiQ93084.

Polymorphism and mutation databases

BioMutaiATP2A3.
DMDMi19864659.

Proteomic databases

MaxQBiQ93084.
PaxDbiQ93084.
PRIDEiQ93084.

Protocols and materials databases

DNASUi489.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
GeneIDi489.
KEGGihsa:489.
UCSCiuc002fwx.2. human. [Q93084-3]
uc002fwy.2. human. [Q93084-5]
uc002fwz.2. human. [Q93084-6]
uc002fxb.2. human. [Q93084-1]
uc002fxc.2. human. [Q93084-2]
uc002fxd.2. human. [Q93084-4]

Organism-specific databases

CTDi489.
GeneCardsiGC17M003822.
HGNCiHGNC:813. ATP2A3.
HPAiCAB010882.
HPA007180.
MIMi601929. gene.
neXtProtiNX_Q93084.
PharmGKBiPA25106.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00760000119003.
HOGENOMiHOG000078632.
HOVERGENiHBG105648.
InParanoidiQ93084.
KOiK05853.
OMAiQREVAIE.
OrthoDBiEOG73Z2SF.
PhylomeDBiQ93084.
TreeFamiTF300651.

Enzyme and pathway databases

ReactomeiREACT_118798. Pre-NOTCH Processing in Golgi.
REACT_23765. Reduction of cytosolic Ca++ levels.
REACT_25149. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSiATP2A3. human.
GeneWikiiATP2A3.
GenomeRNAii489.
NextBioi2037.
PROiQ93084.
SOURCEiSearch...

Gene expression databases

BgeeiQ93084.
CleanExiHS_ATP2A3.
GenevisibleiQ93084. HS.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF280. PTHR24093:SF280. 1 hit.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene."
    Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R.
    Biochem. J. 318:689-699(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A).
    Tissue: Leukemic T-cell.
  2. "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
    Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
    J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C).
  3. "Functional characterization of alternatively spliced human SERCA3 transcripts."
    Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J.
    Am. J. Physiol. 275:C1449-C1458(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3G).
    Tissue: Kidney and Leukemic T-cell.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A).
    Tissue: Ovary.
  7. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1.
    Tissue: Platelet.
  8. Bienvenut W.V., Claeys D.
    Submitted (NOV-2005) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Platelet.
  9. "A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells."
    Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R.
    J. Biol. Chem. 269:1410-1416(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509.
  10. "Three novel sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) 3 isoforms. Expression, regulation, and function of the membranes of the SERCA3 family."
    Martin V., Bredoux R., Corvazier E., Van Gorp R., Kovacs T., Gelebart P., Enouf J.
    J. Biol. Chem. 277:24442-24452(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3D AND SERCA3E), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
  11. "Identification, expression, function, and localization of a novel (sixth) isoform of the human sarco/endoplasmic reticulum Ca2+ATPase 3 gene."
    Bobe R., Bredoux R., Corvazier E., Andersen J.P., Clausen J.D., Dode L., Kovacs T., Enouf J.
    J. Biol. Chem. 279:24297-24306(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORM SERCA3F), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-662, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674.

Entry informationi

Entry nameiAT2A3_HUMAN
AccessioniPrimary (citable) accession number: Q93084
Secondary accession number(s): A8MZG0
, D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: June 24, 2015
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.