Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

ATP2A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.2 Publications

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi305Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi307Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi309Calcium 2By similarity1
Active sitei3514-aspartylphosphate intermediateBy similarity1
Binding sitei515ATPBy similarity1
Metal bindingi703MagnesiumBy similarity1
Metal bindingi707MagnesiumBy similarity1
Metal bindingi768Calcium 1By similarity1
Metal bindingi771Calcium 1By similarity1
Metal bindingi796Calcium 2By similarity1
Metal bindingi799Calcium 1By similarity1
Metal bindingi800Calcium 1By similarity1
Metal bindingi800Calcium 2By similarity1
Metal bindingi908Calcium 1By similarity1

GO - Molecular functioni

GO - Biological processi

  • calcium ion transport Source: UniProtKB
  • cellular calcium ion homeostasis Source: GO_Central
  • ion transmembrane transport Source: Reactome
  • regulation of cardiac conduction Source: Reactome
  • transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS01138-MONOMER.
ReactomeiR-HSA-1912420. Pre-NOTCH Processing in Golgi.
R-HSA-418359. Reduction of cytosolic Ca++ levels.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:ATP2A3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:813. ATP2A3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 48CytoplasmicBy similarityAdd BLAST48
Transmembranei49 – 69Helical; Name=1By similarityAdd BLAST21
Topological domaini70 – 89LumenalBy similarityAdd BLAST20
Transmembranei90 – 110Helical; Name=2By similarityAdd BLAST21
Topological domaini111 – 253CytoplasmicBy similarityAdd BLAST143
Transmembranei254 – 273Helical; Name=3By similarityAdd BLAST20
Topological domaini274 – 295LumenalBy similarityAdd BLAST22
Transmembranei296 – 313Helical; Name=4By similarityAdd BLAST18
Topological domaini314 – 757CytoplasmicBy similarityAdd BLAST444
Transmembranei758 – 777Helical; Name=5By similarityAdd BLAST20
Topological domaini778 – 787LumenalBy similarity10
Transmembranei788 – 808Helical; Name=6By similarityAdd BLAST21
Topological domaini809 – 828CytoplasmicBy similarityAdd BLAST20
Transmembranei829 – 851Helical; Name=7By similarityAdd BLAST23
Topological domaini852 – 897LumenalBy similarityAdd BLAST46
Transmembranei898 – 917Helical; Name=8By similarityAdd BLAST20
Topological domaini918 – 930CytoplasmicBy similarityAdd BLAST13
Transmembranei931 – 949Helical; Name=9By similarityAdd BLAST19
Topological domaini950 – 964LumenalBy similarityAdd BLAST15
Transmembranei965 – 985Helical; Name=10By similarityAdd BLAST21
Topological domaini986 – 1043CytoplasmicBy similarityAdd BLAST58

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

DisGeNETi489.
OpenTargetsiENSG00000074370.
PharmGKBiPA25106.

Polymorphism and mutation databases

BioMutaiATP2A3.
DMDMi19864659.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462021 – 1043Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionine2 Publications1
Modified residuei17PhosphoserineBy similarity1
Modified residuei19PhosphothreonineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei415PhosphothreonineBy similarity1
Modified residuei662PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93084.
PaxDbiQ93084.
PeptideAtlasiQ93084.
PRIDEiQ93084.

PTM databases

iPTMnetiQ93084.
PhosphoSitePlusiQ93084.
SwissPalmiQ93084.

Expressioni

Tissue specificityi

Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines.2 Publications

Gene expression databases

BgeeiENSG00000074370.
CleanExiHS_ATP2A3.
ExpressionAtlasiQ93084. baseline and differential.
GenevisibleiQ93084. HS.

Organism-specific databases

HPAiCAB010882.
HPA007180.

Interactioni

Subunit structurei

Interacts with sarcolipin (SLN) (By similarity). Interacts with phospholamban (PLN) (By similarity). Interacts with myoregulin (MRLN). Interacts with DWORF (By similarity).By similarity

Protein-protein interaction databases

BioGridi106979. 49 interactors.
IntActiQ93084. 6 interactors.
STRINGi9606.ENSP00000353072.

Structurei

3D structure databases

ProteinModelPortaliQ93084.
SMRiQ93084.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni370 – 400Interaction with phospholamban 1By similarityAdd BLAST31
Regioni788 – 808Interaction with phospholamban 2By similarityAdd BLAST21

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00850000132256.
HOGENOMiHOG000078632.
HOVERGENiHBG105648.
InParanoidiQ93084.
KOiK05853.
OMAiWSRQPLT.
OrthoDBiEOG091G01LE.
PhylomeDBiQ93084.
TreeFamiTF300651.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
PRINTSiPR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: The same names have been attributed to different isoforms.
Isoform SERCA3B (identifier: Q93084-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW
60 70 80 90 100
ELVLEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TEAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT SREQILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYSNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHACLYPGL
1010 1020 1030 1040
LRTVSQAWSR QPLTTSWTPD HTGRNEPEVS AGNRVESPVC TSD
Length:1,043
Mass (Da):113,977
Last modified:October 18, 2001 - v2
Checksum:iCB6514B36E00E091
GO
Isoform SERCA3A (identifier: Q93084-2) [UniParc]FASTAAdd to basket
Also known as: HuS3-II

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK

Show »
Length:999
Mass (Da):109,256
Checksum:i44E9F1FBF41FE36A
GO
Isoform SERCA3C (identifier: Q93084-3) [UniParc]FASTAAdd to basket
Also known as: HuS3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK

Show »
Length:1,029
Mass (Da):112,490
Checksum:iF92E6B85AC5BBB81
GO
Isoform SERCA3G (identifier: Q93084-4) [UniParc]FASTAAdd to basket
Also known as: HuS3-I

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK

Show »
Length:998
Mass (Da):109,127
Checksum:i5C1288D99FE36A3D
GO
Isoform SERCA3E (identifier: Q93084-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK

Show »
Length:1,052
Mass (Da):114,931
Checksum:i95DCA1787DEDE2B9
GO
Isoform SERCA3D (identifier: Q93084-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK

Show »
Length:1,044
Mass (Da):114,131
Checksum:i2D26449A0E4EDC9A
GO
Isoform SERCA3F (identifier: Q93084-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ

Show »
Length:1,033
Mass (Da):112,778
Checksum:i02356BCFB8CDA61F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti673A → T in AAC24525 (PubMed:9843705).Curated1
Sequence conflicti802L → H in CAA75739 (PubMed:9593748).Curated1
Sequence conflicti817M → I in CAA93737 (PubMed:8809064).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036498674R → H in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs144535413dbSNPEnsembl.1
Natural variantiVAR_048372869Q → H.Corresponds to variant rs11654827dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000364994 – 1043ACLYP…VCTSD → EEMSQK in isoform SERCA3A. 3 PublicationsAdd BLAST50
Alternative sequenceiVSP_000365994 – 1043ACLYP…VCTSD → EMSQK in isoform SERCA3G. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_042296994 – 1022ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0003661024 – 1043RNEPE…VCTSD → LASLKK in isoform SERCA3C. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0003681024 – 1043RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0003671024 – 1043RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724
, Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSiCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRiI55399.
S72267.
RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneiHs.513870.

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
GeneIDi489.
KEGGihsa:489.
UCSCiuc002fwx.3. human. [Q93084-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724
, Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSiCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRiI55399.
S72267.
RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneiHs.513870.

3D structure databases

ProteinModelPortaliQ93084.
SMRiQ93084.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106979. 49 interactors.
IntActiQ93084. 6 interactors.
STRINGi9606.ENSP00000353072.

PTM databases

iPTMnetiQ93084.
PhosphoSitePlusiQ93084.
SwissPalmiQ93084.

Polymorphism and mutation databases

BioMutaiATP2A3.
DMDMi19864659.

Proteomic databases

MaxQBiQ93084.
PaxDbiQ93084.
PeptideAtlasiQ93084.
PRIDEiQ93084.

Protocols and materials databases

DNASUi489.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
GeneIDi489.
KEGGihsa:489.
UCSCiuc002fwx.3. human. [Q93084-1]

Organism-specific databases

CTDi489.
DisGeNETi489.
GeneCardsiATP2A3.
HGNCiHGNC:813. ATP2A3.
HPAiCAB010882.
HPA007180.
MIMi601929. gene.
neXtProtiNX_Q93084.
OpenTargetsiENSG00000074370.
PharmGKBiPA25106.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00850000132256.
HOGENOMiHOG000078632.
HOVERGENiHBG105648.
InParanoidiQ93084.
KOiK05853.
OMAiWSRQPLT.
OrthoDBiEOG091G01LE.
PhylomeDBiQ93084.
TreeFamiTF300651.

Enzyme and pathway databases

BioCyciZFISH:HS01138-MONOMER.
ReactomeiR-HSA-1912420. Pre-NOTCH Processing in Golgi.
R-HSA-418359. Reduction of cytosolic Ca++ levels.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSiATP2A3. human.
GeneWikiiATP2A3.
GenomeRNAii489.
PROiQ93084.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000074370.
CleanExiHS_ATP2A3.
ExpressionAtlasiQ93084. baseline and differential.
GenevisibleiQ93084. HS.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
PRINTSiPR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAT2A3_HUMAN
AccessioniPrimary (citable) accession number: Q93084
Secondary accession number(s): A8MZG0
, D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: November 2, 2016
This is version 171 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.