Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q93084 (AT2A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 148. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Short name=SERCA3
Short name=SR Ca(2+)-ATPase 3
EC=3.6.3.8
Alternative name(s):
Calcium pump 3
Gene names
Name:ATP2A3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1043 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Ref.11 Ref.12

Catalytic activity

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Subcellular location

Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein Ref.12.

Tissue specificity

Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. Ref.11 Ref.12

Sequence similarities

Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification]

Ontologies

Keywords
   Biological processCalcium transport
Ion transport
Transport
   Cellular componentEndoplasmic reticulum
Membrane
Nucleus
Sarcoplasmic reticulum
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandATP-binding
Calcium
Magnesium
Metal-binding
Nucleotide-binding
   Molecular functionHydrolase
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processblood coagulation

Traceable author statement. Source: Reactome

calcium ion transmembrane transport

Traceable author statement Ref.1. Source: GOC

calcium ion transport

Traceable author statement Ref.1. Source: UniProtKB

ion transmembrane transport

Traceable author statement. Source: Reactome

transmembrane transport

Traceable author statement. Source: Reactome

transport

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentendoplasmic reticulum

Inferred from direct assay Ref.1. Source: UniProtKB

endoplasmic reticulum membrane

Traceable author statement. Source: Reactome

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

nuclear membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

platelet dense tubular network membrane

Traceable author statement. Source: Reactome

sarcoplasmic reticulum

Inferred from direct assay Ref.1. Source: UniProtKB

sarcoplasmic reticulum membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

calcium-transporting ATPase activity

Traceable author statement Ref.1. Source: ProtInc

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]

Note: The same names have been attributed to different isoforms.
Isoform SERCA3B (identifier: Q93084-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform SERCA3A (identifier: Q93084-2)

Also known as: HuS3-II;

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK
Isoform SERCA3C (identifier: Q93084-3)

Also known as: HuS3-IV;

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK
Isoform SERCA3G (identifier: Q93084-4)

Also known as: HuS3-I;

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK
Isoform SERCA3E (identifier: Q93084-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK
Isoform SERCA3D (identifier: Q93084-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK
Isoform SERCA3F (identifier: Q93084-7)

The sequence of this isoform differs from the canonical sequence as follows:
     994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
PRO_0000046202

Regions

Topological domain1 – 4848Cytoplasmic By similarity
Transmembrane49 – 6921Helical; Name=1; By similarity
Topological domain70 – 8920Lumenal By similarity
Transmembrane90 – 11021Helical; Name=2; By similarity
Topological domain111 – 253143Cytoplasmic By similarity
Transmembrane254 – 27320Helical; Name=3; By similarity
Topological domain274 – 29522Lumenal By similarity
Transmembrane296 – 31318Helical; Name=4; By similarity
Topological domain314 – 757444Cytoplasmic By similarity
Transmembrane758 – 77720Helical; Name=5; By similarity
Topological domain778 – 78710Lumenal By similarity
Transmembrane788 – 80821Helical; Name=6; By similarity
Topological domain809 – 82820Cytoplasmic By similarity
Transmembrane829 – 85123Helical; Name=7; By similarity
Topological domain852 – 89746Lumenal By similarity
Transmembrane898 – 91720Helical; Name=8; By similarity
Topological domain918 – 93013Cytoplasmic By similarity
Transmembrane931 – 94919Helical; Name=9; By similarity
Topological domain950 – 96415Lumenal By similarity
Transmembrane965 – 98521Helical; Name=10; By similarity
Topological domain986 – 104358Cytoplasmic By similarity

Sites

Active site35114-aspartylphosphate intermediate By similarity
Metal binding3041Calcium 2; via carbonyl oxygen By similarity
Metal binding3051Calcium 2; via carbonyl oxygen By similarity
Metal binding3071Calcium 2; via carbonyl oxygen By similarity
Metal binding3091Calcium 2 By similarity
Metal binding7031Magnesium By similarity
Metal binding7071Magnesium By similarity
Metal binding7681Calcium 1 By similarity
Metal binding7711Calcium 1 By similarity
Metal binding7961Calcium 2 By similarity
Metal binding7991Calcium 1 By similarity
Metal binding8001Calcium 1 By similarity
Metal binding8001Calcium 2 By similarity
Metal binding9081Calcium 1 By similarity
Binding site5151ATP By similarity

Amino acid modifications

Modified residue11N-acetylmethionine Ref.8 Ref.9
Modified residue6621Phosphoserine Ref.13

Natural variations

Alternative sequence994 – 104350ACLYP…VCTSD → EEMSQK in isoform SERCA3A.
VSP_000364
Alternative sequence994 – 104350ACLYP…VCTSD → EMSQK in isoform SERCA3G.
VSP_000365
Alternative sequence994 – 102229ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F.
VSP_042296
Alternative sequence1024 – 104320RNEPE…VCTSD → LASLKK in isoform SERCA3C.
VSP_000366
Alternative sequence1024 – 104320RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D.
VSP_000368
Alternative sequence1024 – 104320RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E.
VSP_000367
Natural variant6741R → H in a breast cancer sample; somatic mutation. Ref.15
VAR_036498
Natural variant8691Q → H.
Corresponds to variant rs11654827 [ dbSNP | Ensembl ].
VAR_048372

Experimental info

Sequence conflict6731A → T in AAC24525. Ref.4
Sequence conflict8021L → H in CAA75739. Ref.3
Sequence conflict8171M → I in CAA93737. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform SERCA3B [UniParc].

Last modified October 18, 2001. Version 2.
Checksum: CB6514B36E00E091

FASTA1,043113,977
        10         20         30         40         50         60 
MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW ELVLEQFEDL 

        70         80         90        100        110        120 
LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA NAIVGVWQER NAESAIEALK 

       130        140        150        160        170        180 
EYEPEMGKVI RSDRKGVQRI RARDIVPGDI VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL 

       190        200        210        220        230        240 
TGESVSVTKH TEAIPDPRAV NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA 

       250        260        270        280        290        300 
AVEPERTPLQ RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 

       310        320        330        340        350        360 
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS DKTGTLTTNQ 

       370        380        390        400        410        420 
MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ PVRCGQFDGL VELATICALC 

       430        440        450        460        470        480 
NDSALDYNEA KGVYEKVGEA TETALTCLVE KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR 

       490        500        510        520        530        540 
KEFTLEFSRD RKSMSVYCTP TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT 

       550        560        570        580        590        600 
SREQILAKIR DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML 

       610        620        630        640        650        660 
DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG KAYTGREFDD 

       670        680        690        700        710        720 
LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM TGDGVNDAPA LKKAEIGIAM 

       730        740        750        760        770        780 
GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG RAIYSNMKQF IRYLISSNVG EVVCIFLTAI 

       790        800        810        820        830        840 
LGLPEALIPV QLLWVNLVTD GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI 

       850        860        870        880        890        900 
GVYVGLATVA AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA 

       910        920        930        940        950        960 
LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV PPLPLIFQVT 

       970        980        990       1000       1010       1020 
PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHACLYPGL LRTVSQAWSR QPLTTSWTPD 

      1030       1040 
HTGRNEPEVS AGNRVESPVC TSD 

« Hide

Isoform SERCA3A (HuS3-II) [UniParc].

Checksum: 44E9F1FBF41FE36A
Show »

FASTA999109,256
Isoform SERCA3C (HuS3-IV) [UniParc].

Checksum: F92E6B85AC5BBB81
Show »

FASTA1,029112,490
Isoform SERCA3G (HuS3-I) [UniParc].

Checksum: 5C1288D99FE36A3D
Show »

FASTA998109,127
Isoform SERCA3E [UniParc].

Checksum: 95DCA1787DEDE2B9
Show »

FASTA1,052114,931
Isoform SERCA3D [UniParc].

Checksum: 2D26449A0E4EDC9A
Show »

FASTA1,044114,131
Isoform SERCA3F [UniParc].

Checksum: 02356BCFB8CDA61F
Show »

FASTA1,033112,778

References

« Hide 'large scale' references
[1]"cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene."
Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R.
Biochem. J. 318:689-699(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A).
Tissue: Leukemic T-cell.
[2]Erratum
Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R.
Biochem. J. 319:1008-1008(1996)
[3]"Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C).
[4]"Functional characterization of alternatively spliced human SERCA3 transcripts."
Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J.
Am. J. Physiol. 275:C1449-C1458(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3G).
Tissue: Kidney and Leukemic T-cell.
[5]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A).
Tissue: Ovary.
[8]"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1.
Tissue: Platelet.
[9]Bienvenut W.V., Claeys D.
Submitted (NOV-2005) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
Tissue: Platelet.
[10]"A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells."
Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R.
J. Biol. Chem. 269:1410-1416(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509.
[11]"Three novel sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) 3 isoforms. Expression, regulation, and function of the membranes of the SERCA3 family."
Martin V., Bredoux R., Corvazier E., Van Gorp R., Kovacs T., Gelebart P., Enouf J.
J. Biol. Chem. 277:24442-24452(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3D AND SERCA3E), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
[12]"Identification, expression, function, and localization of a novel (sixth) isoform of the human sarco/endoplasmic reticulum Ca2+ATPase 3 gene."
Bobe R., Bredoux R., Corvazier E., Andersen J.P., Clausen J.D., Dode L., Kovacs T., Enouf J.
J. Biol. Chem. 279:24297-24306(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORM SERCA3F), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[13]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-662, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[14]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724 expand/collapse EMBL AC list , Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRI55399.
S72267.
RefSeqNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneHs.513870.

3D structure databases

ProteinModelPortalQ93084.
SMRQ93084. Positions 1-992.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid106979. 8 interactions.
IntActQ93084. 6 interactions.
STRING9606.ENSP00000353072.

PTM databases

PhosphoSiteQ93084.

Polymorphism databases

DMDM19864659.

Proteomic databases

MaxQBQ93084.
PaxDbQ93084.
PRIDEQ93084.

Protocols and materials databases

DNASU489.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
ENST00000570845; ENSP00000461480; ENSG00000074370.
ENST00000572116; ENSP00000458865; ENSG00000074370.
GeneID489.
KEGGhsa:489.
UCSCuc002fwx.2. human. [Q93084-3]
uc002fwy.2. human. [Q93084-5]
uc002fwz.2. human. [Q93084-6]
uc002fxb.2. human. [Q93084-1]
uc002fxc.2. human. [Q93084-2]
uc002fxd.2. human. [Q93084-4]

Organism-specific databases

CTD489.
GeneCardsGC17M003822.
HGNCHGNC:813. ATP2A3.
HPACAB010882.
HPA007180.
MIM601929. gene.
neXtProtNX_Q93084.
PharmGKBPA25106.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0474.
HOGENOMHOG000078632.
HOVERGENHBG105648.
KOK05853.
OMAACITRCY.
OrthoDBEOG73Z2SF.
PhylomeDBQ93084.
TreeFamTF300651.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.
REACT_604. Hemostasis.

Gene expression databases

ArrayExpressQ93084.
BgeeQ93084.
CleanExHS_ATP2A3.
GenevestigatorQ93084.

Family and domain databases

Gene3D1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSPR00119. CATATPASE.
PR00120. HATPASE.
SMARTSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiATP2A3.
GenomeRNAi489.
NextBio2037.
PROQ93084.
SOURCESearch...

Entry information

Entry nameAT2A3_HUMAN
AccessionPrimary (citable) accession number: Q93084
Secondary accession number(s): A8MZG0 expand/collapse secondary AC list , D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: July 9, 2014
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM