SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q93084

- AT2A3_HUMAN

UniProt

Q93084 - AT2A3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene
ATP2A3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.2 Publications

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygen By similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygen By similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygen By similarity
Metal bindingi309 – 3091Calcium 2 By similarity
Active sitei351 – 35114-aspartylphosphate intermediate By similarity
Binding sitei515 – 5151ATP By similarity
Metal bindingi703 – 7031Magnesium By similarity
Metal bindingi707 – 7071Magnesium By similarity
Metal bindingi768 – 7681Calcium 1 By similarity
Metal bindingi771 – 7711Calcium 1 By similarity
Metal bindingi796 – 7961Calcium 2 By similarity
Metal bindingi799 – 7991Calcium 1 By similarity
Metal bindingi800 – 8001Calcium 1 By similarity
Metal bindingi800 – 8001Calcium 2 By similarity
Metal bindingi908 – 9081Calcium 1 By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. calcium-transporting ATPase activity Source: ProtInc
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. calcium ion transmembrane transport Source: GOC
  3. calcium ion transport Source: UniProtKB
  4. ion transmembrane transport Source: Reactome
  5. transmembrane transport Source: Reactome
  6. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_118798. Pre-NOTCH Processing in Golgi.
REACT_23765. Reduction of cytosolic Ca++ levels.
REACT_25149. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:ATP2A3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:813. ATP2A3.

Subcellular locationi

Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848Cytoplasmic By similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1; By similarityAdd
BLAST
Topological domaini70 – 8920Lumenal By similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2; By similarityAdd
BLAST
Topological domaini111 – 253143Cytoplasmic By similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3; By similarityAdd
BLAST
Topological domaini274 – 29522Lumenal By similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4; By similarityAdd
BLAST
Topological domaini314 – 757444Cytoplasmic By similarityAdd
BLAST
Transmembranei758 – 77720Helical; Name=5; By similarityAdd
BLAST
Topological domaini778 – 78710Lumenal By similarity
Transmembranei788 – 80821Helical; Name=6; By similarityAdd
BLAST
Topological domaini809 – 82820Cytoplasmic By similarityAdd
BLAST
Transmembranei829 – 85123Helical; Name=7; By similarityAdd
BLAST
Topological domaini852 – 89746Lumenal By similarityAdd
BLAST
Transmembranei898 – 91720Helical; Name=8; By similarityAdd
BLAST
Topological domaini918 – 93013Cytoplasmic By similarityAdd
BLAST
Transmembranei931 – 94919Helical; Name=9; By similarityAdd
BLAST
Topological domaini950 – 96415Lumenal By similarityAdd
BLAST
Transmembranei965 – 98521Helical; Name=10; By similarityAdd
BLAST
Topological domaini986 – 104358Cytoplasmic By similarityAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB
  2. endoplasmic reticulum membrane Source: Reactome
  3. integral component of membrane Source: UniProtKB-KW
  4. nuclear membrane Source: UniProtKB-SubCell
  5. platelet dense tubular network membrane Source: Reactome
  6. sarcoplasmic reticulum Source: UniProtKB
  7. sarcoplasmic reticulum membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25106.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046202Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications
Modified residuei662 – 6621Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93084.
PaxDbiQ93084.
PRIDEiQ93084.

PTM databases

PhosphoSiteiQ93084.

Expressioni

Tissue specificityi

Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines.2 Publications

Gene expression databases

ArrayExpressiQ93084.
BgeeiQ93084.
CleanExiHS_ATP2A3.
GenevestigatoriQ93084.

Organism-specific databases

HPAiCAB010882.
HPA007180.

Interactioni

Protein-protein interaction databases

BioGridi106979. 8 interactions.
IntActiQ93084. 6 interactions.
STRINGi9606.ENSP00000353072.

Structurei

3D structure databases

ProteinModelPortaliQ93084.
SMRiQ93084. Positions 1-992.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000078632.
HOVERGENiHBG105648.
KOiK05853.
OMAiACITRCY.
OrthoDBiEOG73Z2SF.
PhylomeDBiQ93084.
TreeFamiTF300651.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Note: The same names have been attributed to different isoforms.

Isoform SERCA3B (identifier: Q93084-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW     50
ELVLEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA 100
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI 150
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TEAIPDPRAV 200
NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA AVEPERTPLQ 250
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 300
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS 350
DKTGTLTTNQ MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ 400
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR KEFTLEFSRD RKSMSVYCTP 500
TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT SREQILAKIR 550
DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML 600
DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG 650
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM 700
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG 750
RAIYSNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD 800
GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI GVYVGLATVA 850
AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA 900
LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV 950
PPLPLIFQVT PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHACLYPGL 1000
LRTVSQAWSR QPLTTSWTPD HTGRNEPEVS AGNRVESPVC TSD 1043
Length:1,043
Mass (Da):113,977
Last modified:October 18, 2001 - v2
Checksum:iCB6514B36E00E091
GO
Isoform SERCA3A (identifier: Q93084-2) [UniParc]FASTAAdd to Basket

Also known as: HuS3-II

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK

Show »
Length:999
Mass (Da):109,256
Checksum:i44E9F1FBF41FE36A
GO
Isoform SERCA3C (identifier: Q93084-3) [UniParc]FASTAAdd to Basket

Also known as: HuS3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK

Show »
Length:1,029
Mass (Da):112,490
Checksum:iF92E6B85AC5BBB81
GO
Isoform SERCA3G (identifier: Q93084-4) [UniParc]FASTAAdd to Basket

Also known as: HuS3-I

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK

Show »
Length:998
Mass (Da):109,127
Checksum:i5C1288D99FE36A3D
GO
Isoform SERCA3E (identifier: Q93084-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK

Show »
Length:1,052
Mass (Da):114,931
Checksum:i95DCA1787DEDE2B9
GO
Isoform SERCA3D (identifier: Q93084-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK

Show »
Length:1,044
Mass (Da):114,131
Checksum:i2D26449A0E4EDC9A
GO
Isoform SERCA3F (identifier: Q93084-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ

Show »
Length:1,033
Mass (Da):112,778
Checksum:i02356BCFB8CDA61F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti674 – 6741R → H in a breast cancer sample; somatic mutation. 1 Publication
VAR_036498
Natural varianti869 – 8691Q → H.
Corresponds to variant rs11654827 [ dbSNP | Ensembl ].
VAR_048372

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 104350ACLYP…VCTSD → EEMSQK in isoform SERCA3A. VSP_000364Add
BLAST
Alternative sequencei994 – 104350ACLYP…VCTSD → EMSQK in isoform SERCA3G. VSP_000365Add
BLAST
Alternative sequencei994 – 102229ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F. VSP_042296Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLKK in isoform SERCA3C. VSP_000366Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D. VSP_000368Add
BLAST
Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E. VSP_000367Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti673 – 6731A → T in AAC24525. 1 Publication
Sequence conflicti802 – 8021L → H in CAA75739. 1 Publication
Sequence conflicti817 – 8171M → I in CAA93737. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z69881 mRNA. Translation: CAA93737.1.
Z69880 Genomic DNA. Translation: CAA93736.1.
Y15724
, Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
Y15738 Genomic DNA. Translation: CAA75748.1.
Y15737 Genomic DNA. Translation: CAA75747.1.
AF068220 mRNA. Translation: AAC24525.1.
AF068221 mRNA. Translation: AAC24526.1.
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1.
CH471108 Genomic DNA. Translation: EAW90463.1.
CH471108 Genomic DNA. Translation: EAW90469.1.
BC035729 mRNA. Translation: AAH35729.1.
S68239 mRNA. Translation: AAB29700.1.
AF458228 mRNA. Translation: AAL78967.1.
AF458229 mRNA. Translation: AAL78968.1.
AY460339 mRNA. Translation: AAR15415.1.
CCDSiCCDS11041.1. [Q93084-1]
CCDS11042.1. [Q93084-5]
CCDS42234.1. [Q93084-3]
CCDS45579.1. [Q93084-2]
CCDS45580.1. [Q93084-4]
PIRiI55399.
S72267.
RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
NP_777613.1. NM_174953.2. [Q93084-5]
NP_777614.1. NM_174954.2. [Q93084-6]
NP_777615.1. NM_174955.2. [Q93084-1]
NP_777616.1. NM_174956.2. [Q93084-3]
NP_777617.1. NM_174957.2. [Q93084-4]
NP_777618.1. NM_174958.2. [Q93084-3]
UniGeneiHs.513870.

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
ENST00000570845; ENSP00000461480; ENSG00000074370.
ENST00000572116; ENSP00000458865; ENSG00000074370.
GeneIDi489.
KEGGihsa:489.
UCSCiuc002fwx.2. human. [Q93084-3]
uc002fwy.2. human. [Q93084-5]
uc002fwz.2. human. [Q93084-6]
uc002fxb.2. human. [Q93084-1]
uc002fxc.2. human. [Q93084-2]
uc002fxd.2. human. [Q93084-4]

Polymorphism databases

DMDMi19864659.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z69881 mRNA. Translation: CAA93737.1 .
Z69880 Genomic DNA. Translation: CAA93736.1 .
Y15724
, Y15725 , Y15726 , Y15727 , Y15728 , Y15729 , Y15730 Genomic DNA. Translation: CAA75739.1 .
Y15738 Genomic DNA. Translation: CAA75748.1 .
Y15737 Genomic DNA. Translation: CAA75747.1 .
AF068220 mRNA. Translation: AAC24525.1 .
AF068221 mRNA. Translation: AAC24526.1 .
AC005940 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90468.1 .
CH471108 Genomic DNA. Translation: EAW90463.1 .
CH471108 Genomic DNA. Translation: EAW90469.1 .
BC035729 mRNA. Translation: AAH35729.1 .
S68239 mRNA. Translation: AAB29700.1 .
AF458228 mRNA. Translation: AAL78967.1 .
AF458229 mRNA. Translation: AAL78968.1 .
AY460339 mRNA. Translation: AAR15415.1 .
CCDSi CCDS11041.1. [Q93084-1 ]
CCDS11042.1. [Q93084-5 ]
CCDS42234.1. [Q93084-3 ]
CCDS45579.1. [Q93084-2 ]
CCDS45580.1. [Q93084-4 ]
PIRi I55399.
S72267.
RefSeqi NP_005164.2. NM_005173.3. [Q93084-2 ]
NP_777613.1. NM_174953.2. [Q93084-5 ]
NP_777614.1. NM_174954.2. [Q93084-6 ]
NP_777615.1. NM_174955.2. [Q93084-1 ]
NP_777616.1. NM_174956.2. [Q93084-3 ]
NP_777617.1. NM_174957.2. [Q93084-4 ]
NP_777618.1. NM_174958.2. [Q93084-3 ]
UniGenei Hs.513870.

3D structure databases

ProteinModelPortali Q93084.
SMRi Q93084. Positions 1-992.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106979. 8 interactions.
IntActi Q93084. 6 interactions.
STRINGi 9606.ENSP00000353072.

PTM databases

PhosphoSitei Q93084.

Polymorphism databases

DMDMi 19864659.

Proteomic databases

MaxQBi Q93084.
PaxDbi Q93084.
PRIDEi Q93084.

Protocols and materials databases

DNASUi 489.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000309890 ; ENSP00000312577 ; ENSG00000074370 . [Q93084-3 ]
ENST00000352011 ; ENSP00000301387 ; ENSG00000074370 . [Q93084-1 ]
ENST00000359983 ; ENSP00000353072 ; ENSG00000074370 . [Q93084-5 ]
ENST00000397035 ; ENSP00000380229 ; ENSG00000074370 . [Q93084-3 ]
ENST00000397041 ; ENSP00000380234 ; ENSG00000074370 . [Q93084-2 ]
ENST00000397043 ; ENSP00000380236 ; ENSG00000074370 . [Q93084-4 ]
ENST00000570845 ; ENSP00000461480 ; ENSG00000074370 .
ENST00000572116 ; ENSP00000458865 ; ENSG00000074370 .
GeneIDi 489.
KEGGi hsa:489.
UCSCi uc002fwx.2. human. [Q93084-3 ]
uc002fwy.2. human. [Q93084-5 ]
uc002fwz.2. human. [Q93084-6 ]
uc002fxb.2. human. [Q93084-1 ]
uc002fxc.2. human. [Q93084-2 ]
uc002fxd.2. human. [Q93084-4 ]

Organism-specific databases

CTDi 489.
GeneCardsi GC17M003822.
HGNCi HGNC:813. ATP2A3.
HPAi CAB010882.
HPA007180.
MIMi 601929. gene.
neXtProti NX_Q93084.
PharmGKBi PA25106.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0474.
HOGENOMi HOG000078632.
HOVERGENi HBG105648.
KOi K05853.
OMAi ACITRCY.
OrthoDBi EOG73Z2SF.
PhylomeDBi Q93084.
TreeFami TF300651.

Enzyme and pathway databases

Reactomei REACT_118798. Pre-NOTCH Processing in Golgi.
REACT_23765. Reduction of cytosolic Ca++ levels.
REACT_25149. Ion transport by P-type ATPases.

Miscellaneous databases

GeneWikii ATP2A3.
GenomeRNAii 489.
NextBioi 2037.
PROi Q93084.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q93084.
Bgeei Q93084.
CleanExi HS_ATP2A3.
Genevestigatori Q93084.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
PR00120. HATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene."
    Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R.
    Biochem. J. 318:689-699(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A).
    Tissue: Leukemic T-cell.
  2. "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
    Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
    J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C).
  3. "Functional characterization of alternatively spliced human SERCA3 transcripts."
    Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J.
    Am. J. Physiol. 275:C1449-C1458(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3G).
    Tissue: Kidney and Leukemic T-cell.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A).
    Tissue: Ovary.
  7. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1.
    Tissue: Platelet.
  8. Bienvenut W.V., Claeys D.
    Submitted (NOV-2005) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Platelet.
  9. "A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells."
    Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R.
    J. Biol. Chem. 269:1410-1416(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509.
  10. "Three novel sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) 3 isoforms. Expression, regulation, and function of the membranes of the SERCA3 family."
    Martin V., Bredoux R., Corvazier E., Van Gorp R., Kovacs T., Gelebart P., Enouf J.
    J. Biol. Chem. 277:24442-24452(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3D AND SERCA3E), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
  11. "Identification, expression, function, and localization of a novel (sixth) isoform of the human sarco/endoplasmic reticulum Ca2+ATPase 3 gene."
    Bobe R., Bredoux R., Corvazier E., Andersen J.P., Clausen J.D., Dode L., Kovacs T., Enouf J.
    J. Biol. Chem. 279:24297-24306(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORM SERCA3F), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-662, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674.

Entry informationi

Entry nameiAT2A3_HUMAN
AccessioniPrimary (citable) accession number: Q93084
Secondary accession number(s): A8MZG0
, D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: September 3, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi