Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q93084

- AT2A3_HUMAN

UniProt

Q93084 - AT2A3_HUMAN

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

ATP2A3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 2 (18 Oct 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.2 Publications

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi309 – 3091Calcium 2By similarity
    Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
    Binding sitei515 – 5151ATPBy similarity
    Metal bindingi703 – 7031MagnesiumBy similarity
    Metal bindingi707 – 7071MagnesiumBy similarity
    Metal bindingi768 – 7681Calcium 1By similarity
    Metal bindingi771 – 7711Calcium 1By similarity
    Metal bindingi796 – 7961Calcium 2By similarity
    Metal bindingi799 – 7991Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 2By similarity
    Metal bindingi908 – 9081Calcium 1By similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. calcium-transporting ATPase activity Source: ProtInc
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. calcium ion transmembrane transport Source: GOC
    3. calcium ion transport Source: UniProtKB
    4. ion transmembrane transport Source: Reactome
    5. transmembrane transport Source: Reactome
    6. transport Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_118798. Pre-NOTCH Processing in Golgi.
    REACT_23765. Reduction of cytosolic Ca++ levels.
    REACT_25149. Ion transport by P-type ATPases.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
    Short name:
    SERCA3
    Short name:
    SR Ca(2+)-ATPase 3
    Alternative name(s):
    Calcium pump 3
    Gene namesi
    Name:ATP2A3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:813. ATP2A3.

    Subcellular locationi

    Nucleus membrane 1 Publication; Multi-pass membrane protein 1 Publication. Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication. Sarcoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB
    2. endoplasmic reticulum membrane Source: Reactome
    3. integral component of membrane Source: UniProtKB-KW
    4. nuclear membrane Source: UniProtKB-SubCell
    5. platelet dense tubular network membrane Source: Reactome
    6. sarcoplasmic reticulum Source: UniProtKB
    7. sarcoplasmic reticulum membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25106.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046202Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine2 Publications
    Modified residuei662 – 6621Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ93084.
    PaxDbiQ93084.
    PRIDEiQ93084.

    PTM databases

    PhosphoSiteiQ93084.

    Expressioni

    Tissue specificityi

    Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines.2 Publications

    Gene expression databases

    ArrayExpressiQ93084.
    BgeeiQ93084.
    CleanExiHS_ATP2A3.
    GenevestigatoriQ93084.

    Organism-specific databases

    HPAiCAB010882.
    HPA007180.

    Interactioni

    Protein-protein interaction databases

    BioGridi106979. 8 interactions.
    IntActiQ93084. 6 interactions.
    STRINGi9606.ENSP00000353072.

    Structurei

    3D structure databases

    ProteinModelPortaliQ93084.
    SMRiQ93084. Positions 1-992.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4848CytoplasmicBy similarityAdd
    BLAST
    Topological domaini70 – 8920LumenalBy similarityAdd
    BLAST
    Topological domaini111 – 253143CytoplasmicBy similarityAdd
    BLAST
    Topological domaini274 – 29522LumenalBy similarityAdd
    BLAST
    Topological domaini314 – 757444CytoplasmicBy similarityAdd
    BLAST
    Topological domaini778 – 78710LumenalBy similarity
    Topological domaini809 – 82820CytoplasmicBy similarityAdd
    BLAST
    Topological domaini852 – 89746LumenalBy similarityAdd
    BLAST
    Topological domaini918 – 93013CytoplasmicBy similarityAdd
    BLAST
    Topological domaini950 – 96415LumenalBy similarityAdd
    BLAST
    Topological domaini986 – 104358CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei49 – 6921Helical; Name=1By similarityAdd
    BLAST
    Transmembranei90 – 11021Helical; Name=2By similarityAdd
    BLAST
    Transmembranei254 – 27320Helical; Name=3By similarityAdd
    BLAST
    Transmembranei296 – 31318Helical; Name=4By similarityAdd
    BLAST
    Transmembranei758 – 77720Helical; Name=5By similarityAdd
    BLAST
    Transmembranei788 – 80821Helical; Name=6By similarityAdd
    BLAST
    Transmembranei829 – 85123Helical; Name=7By similarityAdd
    BLAST
    Transmembranei898 – 91720Helical; Name=8By similarityAdd
    BLAST
    Transmembranei931 – 94919Helical; Name=9By similarityAdd
    BLAST
    Transmembranei965 – 98521Helical; Name=10By similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOGENOMiHOG000078632.
    HOVERGENiHBG105648.
    KOiK05853.
    OMAiACITRCY.
    OrthoDBiEOG73Z2SF.
    PhylomeDBiQ93084.
    TreeFamiTF300651.

    Family and domain databases

    Gene3Di1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    PR00120. HATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Note: The same names have been attributed to different isoforms.

    Isoform SERCA3B (identifier: Q93084-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW     50
    ELVLEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA 100
    NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI 150
    VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TEAIPDPRAV 200
    NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA AVEPERTPLQ 250
    RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 300
    ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS 350
    DKTGTLTTNQ MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ 400
    PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
    KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR KEFTLEFSRD RKSMSVYCTP 500
    TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT SREQILAKIR 550
    DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML 600
    DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG 650
    KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM 700
    TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG 750
    RAIYSNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD 800
    GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI GVYVGLATVA 850
    AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA 900
    LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV 950
    PPLPLIFQVT PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHACLYPGL 1000
    LRTVSQAWSR QPLTTSWTPD HTGRNEPEVS AGNRVESPVC TSD 1043
    Length:1,043
    Mass (Da):113,977
    Last modified:October 18, 2001 - v2
    Checksum:iCB6514B36E00E091
    GO
    Isoform SERCA3A (identifier: Q93084-2) [UniParc]FASTAAdd to Basket

    Also known as: HuS3-II

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EEMSQK

    Show »
    Length:999
    Mass (Da):109,256
    Checksum:i44E9F1FBF41FE36A
    GO
    Isoform SERCA3C (identifier: Q93084-3) [UniParc]FASTAAdd to Basket

    Also known as: HuS3-IV

    The sequence of this isoform differs from the canonical sequence as follows:
         1024-1043: RNEPEVSAGNRVESPVCTSD → LASLKK

    Show »
    Length:1,029
    Mass (Da):112,490
    Checksum:iF92E6B85AC5BBB81
    GO
    Isoform SERCA3G (identifier: Q93084-4) [UniParc]FASTAAdd to Basket

    Also known as: HuS3-I

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1043: ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD → EMSQK

    Show »
    Length:998
    Mass (Da):109,127
    Checksum:i5C1288D99FE36A3D
    GO
    Isoform SERCA3E (identifier: Q93084-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1024-1043: RNEPEVSAGNRVESPVCTSD → LASLGQGHSIVSLSELLREGGSREEMSQK

    Show »
    Length:1,052
    Mass (Da):114,931
    Checksum:i95DCA1787DEDE2B9
    GO
    Isoform SERCA3D (identifier: Q93084-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1024-1043: RNEPEVSAGNRVESPVCTSD → ARDTASSRCQSCSEREEAGKK

    Show »
    Length:1,044
    Mass (Da):114,131
    Checksum:i2D26449A0E4EDC9A
    GO
    Isoform SERCA3F (identifier: Q93084-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1022: ACLYPGLLRTVSQAWSRQPLTTSWTPDHT → GPGTQHRLAVRAAQRGRKQ

    Show »
    Length:1,033
    Mass (Da):112,778
    Checksum:i02356BCFB8CDA61F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti673 – 6731A → T in AAC24525. (PubMed:9843705)Curated
    Sequence conflicti802 – 8021L → H in CAA75739. (PubMed:9593748)Curated
    Sequence conflicti817 – 8171M → I in CAA93737. (PubMed:8809064)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti674 – 6741R → H in a breast cancer sample; somatic mutation. 1 Publication
    VAR_036498
    Natural varianti869 – 8691Q → H.
    Corresponds to variant rs11654827 [ dbSNP | Ensembl ].
    VAR_048372

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei994 – 104350ACLYP…VCTSD → EEMSQK in isoform SERCA3A. 3 PublicationsVSP_000364Add
    BLAST
    Alternative sequencei994 – 104350ACLYP…VCTSD → EMSQK in isoform SERCA3G. 1 PublicationVSP_000365Add
    BLAST
    Alternative sequencei994 – 102229ACLYP…TPDHT → GPGTQHRLAVRAAQRGRKQ in isoform SERCA3F. 1 PublicationVSP_042296Add
    BLAST
    Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLKK in isoform SERCA3C. 1 PublicationVSP_000366Add
    BLAST
    Alternative sequencei1024 – 104320RNEPE…VCTSD → ARDTASSRCQSCSEREEAGK K in isoform SERCA3D. 1 PublicationVSP_000368Add
    BLAST
    Alternative sequencei1024 – 104320RNEPE…VCTSD → LASLGQGHSIVSLSELLREG GSREEMSQK in isoform SERCA3E. 1 PublicationVSP_000367Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z69881 mRNA. Translation: CAA93737.1.
    Z69880 Genomic DNA. Translation: CAA93736.1.
    Y15724
    , Y15725, Y15726, Y15727, Y15728, Y15729, Y15730 Genomic DNA. Translation: CAA75739.1.
    Y15738 Genomic DNA. Translation: CAA75748.1.
    Y15737 Genomic DNA. Translation: CAA75747.1.
    AF068220 mRNA. Translation: AAC24525.1.
    AF068221 mRNA. Translation: AAC24526.1.
    AC005940 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90468.1.
    CH471108 Genomic DNA. Translation: EAW90463.1.
    CH471108 Genomic DNA. Translation: EAW90469.1.
    BC035729 mRNA. Translation: AAH35729.1.
    S68239 mRNA. Translation: AAB29700.1.
    AF458228 mRNA. Translation: AAL78967.1.
    AF458229 mRNA. Translation: AAL78968.1.
    AY460339 mRNA. Translation: AAR15415.1.
    CCDSiCCDS11041.1. [Q93084-1]
    CCDS11042.1. [Q93084-5]
    CCDS42234.1. [Q93084-3]
    CCDS45579.1. [Q93084-2]
    CCDS45580.1. [Q93084-4]
    PIRiI55399.
    S72267.
    RefSeqiNP_005164.2. NM_005173.3. [Q93084-2]
    NP_777613.1. NM_174953.2. [Q93084-5]
    NP_777614.1. NM_174954.2. [Q93084-6]
    NP_777615.1. NM_174955.2. [Q93084-1]
    NP_777616.1. NM_174956.2. [Q93084-3]
    NP_777617.1. NM_174957.2. [Q93084-4]
    NP_777618.1. NM_174958.2. [Q93084-3]
    UniGeneiHs.513870.

    Genome annotation databases

    EnsembliENST00000309890; ENSP00000312577; ENSG00000074370. [Q93084-3]
    ENST00000352011; ENSP00000301387; ENSG00000074370. [Q93084-1]
    ENST00000359983; ENSP00000353072; ENSG00000074370. [Q93084-5]
    ENST00000397035; ENSP00000380229; ENSG00000074370. [Q93084-3]
    ENST00000397041; ENSP00000380234; ENSG00000074370. [Q93084-2]
    ENST00000397043; ENSP00000380236; ENSG00000074370. [Q93084-4]
    ENST00000570845; ENSP00000461480; ENSG00000074370.
    ENST00000572116; ENSP00000458865; ENSG00000074370.
    GeneIDi489.
    KEGGihsa:489.
    UCSCiuc002fwx.2. human. [Q93084-3]
    uc002fwy.2. human. [Q93084-5]
    uc002fwz.2. human. [Q93084-6]
    uc002fxb.2. human. [Q93084-1]
    uc002fxc.2. human. [Q93084-2]
    uc002fxd.2. human. [Q93084-4]

    Polymorphism databases

    DMDMi19864659.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z69881 mRNA. Translation: CAA93737.1 .
    Z69880 Genomic DNA. Translation: CAA93736.1 .
    Y15724
    , Y15725 , Y15726 , Y15727 , Y15728 , Y15729 , Y15730 Genomic DNA. Translation: CAA75739.1 .
    Y15738 Genomic DNA. Translation: CAA75748.1 .
    Y15737 Genomic DNA. Translation: CAA75747.1 .
    AF068220 mRNA. Translation: AAC24525.1 .
    AF068221 mRNA. Translation: AAC24526.1 .
    AC005940 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90468.1 .
    CH471108 Genomic DNA. Translation: EAW90463.1 .
    CH471108 Genomic DNA. Translation: EAW90469.1 .
    BC035729 mRNA. Translation: AAH35729.1 .
    S68239 mRNA. Translation: AAB29700.1 .
    AF458228 mRNA. Translation: AAL78967.1 .
    AF458229 mRNA. Translation: AAL78968.1 .
    AY460339 mRNA. Translation: AAR15415.1 .
    CCDSi CCDS11041.1. [Q93084-1 ]
    CCDS11042.1. [Q93084-5 ]
    CCDS42234.1. [Q93084-3 ]
    CCDS45579.1. [Q93084-2 ]
    CCDS45580.1. [Q93084-4 ]
    PIRi I55399.
    S72267.
    RefSeqi NP_005164.2. NM_005173.3. [Q93084-2 ]
    NP_777613.1. NM_174953.2. [Q93084-5 ]
    NP_777614.1. NM_174954.2. [Q93084-6 ]
    NP_777615.1. NM_174955.2. [Q93084-1 ]
    NP_777616.1. NM_174956.2. [Q93084-3 ]
    NP_777617.1. NM_174957.2. [Q93084-4 ]
    NP_777618.1. NM_174958.2. [Q93084-3 ]
    UniGenei Hs.513870.

    3D structure databases

    ProteinModelPortali Q93084.
    SMRi Q93084. Positions 1-992.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106979. 8 interactions.
    IntActi Q93084. 6 interactions.
    STRINGi 9606.ENSP00000353072.

    PTM databases

    PhosphoSitei Q93084.

    Polymorphism databases

    DMDMi 19864659.

    Proteomic databases

    MaxQBi Q93084.
    PaxDbi Q93084.
    PRIDEi Q93084.

    Protocols and materials databases

    DNASUi 489.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000309890 ; ENSP00000312577 ; ENSG00000074370 . [Q93084-3 ]
    ENST00000352011 ; ENSP00000301387 ; ENSG00000074370 . [Q93084-1 ]
    ENST00000359983 ; ENSP00000353072 ; ENSG00000074370 . [Q93084-5 ]
    ENST00000397035 ; ENSP00000380229 ; ENSG00000074370 . [Q93084-3 ]
    ENST00000397041 ; ENSP00000380234 ; ENSG00000074370 . [Q93084-2 ]
    ENST00000397043 ; ENSP00000380236 ; ENSG00000074370 . [Q93084-4 ]
    ENST00000570845 ; ENSP00000461480 ; ENSG00000074370 .
    ENST00000572116 ; ENSP00000458865 ; ENSG00000074370 .
    GeneIDi 489.
    KEGGi hsa:489.
    UCSCi uc002fwx.2. human. [Q93084-3 ]
    uc002fwy.2. human. [Q93084-5 ]
    uc002fwz.2. human. [Q93084-6 ]
    uc002fxb.2. human. [Q93084-1 ]
    uc002fxc.2. human. [Q93084-2 ]
    uc002fxd.2. human. [Q93084-4 ]

    Organism-specific databases

    CTDi 489.
    GeneCardsi GC17M003822.
    HGNCi HGNC:813. ATP2A3.
    HPAi CAB010882.
    HPA007180.
    MIMi 601929. gene.
    neXtProti NX_Q93084.
    PharmGKBi PA25106.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0474.
    HOGENOMi HOG000078632.
    HOVERGENi HBG105648.
    KOi K05853.
    OMAi ACITRCY.
    OrthoDBi EOG73Z2SF.
    PhylomeDBi Q93084.
    TreeFami TF300651.

    Enzyme and pathway databases

    Reactomei REACT_118798. Pre-NOTCH Processing in Golgi.
    REACT_23765. Reduction of cytosolic Ca++ levels.
    REACT_25149. Ion transport by P-type ATPases.

    Miscellaneous databases

    GeneWikii ATP2A3.
    GenomeRNAii 489.
    NextBioi 2037.
    PROi Q93084.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q93084.
    Bgeei Q93084.
    CleanExi HS_ATP2A3.
    Genevestigatori Q93084.

    Family and domain databases

    Gene3Di 1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    PR00120. HATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning, expression and chromosomal localization of the human sarco/endoplasmic reticulum Ca(2+)-ATPase 3 gene."
      Dode L., Wuytack F., Kools P.F.J., Baba-Aissa F., Raeymaekers L., Brik F., van de Ven W.J.M., Casteels R.
      Biochem. J. 318:689-699(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SERCA3A).
      Tissue: Leukemic T-cell.
    2. "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
      Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
      J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS SERCA3B AND SERCA3C).
    3. "Functional characterization of alternatively spliced human SERCA3 transcripts."
      Poch E., Leach S., Snape S., Cacic T., McLennan D.H., Lytton J.
      Am. J. Physiol. 275:C1449-C1458(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A; SERCA3C AND SERCA3G).
      Tissue: Kidney and Leukemic T-cell.
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA3A).
      Tissue: Ovary.
    7. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
      Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
      Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1.
      Tissue: Platelet.
    8. Bienvenut W.V., Claeys D.
      Submitted (NOV-2005) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 1-33; 111-120; 219-234; 482-489; 516-524; 549-560 AND 657-667, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Platelet.
    9. "A sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump is expressed in platelets, in lymphoid cells, and in mast cells."
      Wuytack F., Papp B., Verboomen H., Raeymaekers L., Dode L., Bobe R., Enouf J., Bokkala S., Authi K.S., Casteels R.
      J. Biol. Chem. 269:1410-1416(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 454-509.
    10. "Three novel sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) 3 isoforms. Expression, regulation, and function of the membranes of the SERCA3 family."
      Martin V., Bredoux R., Corvazier E., Van Gorp R., Kovacs T., Gelebart P., Enouf J.
      J. Biol. Chem. 277:24442-24452(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORMS SERCA3D AND SERCA3E), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
    11. "Identification, expression, function, and localization of a novel (sixth) isoform of the human sarco/endoplasmic reticulum Ca2+ATPase 3 gene."
      Bobe R., Bredoux R., Corvazier E., Andersen J.P., Clausen J.D., Dode L., Kovacs T., Enouf J.
      J. Biol. Chem. 279:24297-24306(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 892-1043 (ISOFORM SERCA3F), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-662, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-674.

    Entry informationi

    Entry nameiAT2A3_HUMAN
    AccessioniPrimary (citable) accession number: Q93084
    Secondary accession number(s): A8MZG0
    , D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: October 18, 2001
    Last modified: October 1, 2014
    This is version 150 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3