Q93063 (EXT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Exostosin-2 EC=2.4.1.224 EC=2.4.1.225 Alternative name(s): Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase Multiple exostoses protein 2 Putative tumor suppressor protein EXT2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 718 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Glycosyltransferase required for the biosynthesis of heparan-sulfate. The EXT1/EXT2 complex possesses substantially higher glycosyltransferase activity than EXT1 or EXT2 alone. Appears to be a tumor suppressor. |
| Catalytic activity | UDP-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->4)-N-acetyl-alpha-D-glucosaminyl-proteoglycan = UDP + N-acetyl-alpha-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->4)-N-acetyl-alpha-D-glucosaminyl-proteoglycan. UDP-alpha-D-glucuronate + N-acetyl-alpha-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-proteoglycan = UDP + beta-D-glucuronosyl-(1->4)-N-acetyl-alpha-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-proteoglycan. |
| Pathway | |
| Subunit structure | Forms a homo/hetero-oligomeric complex with EXT1. Interacts with GALNT5. Ref.8 Ref.9 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus membrane; Single-pass type II membrane protein. Note: The EXT1/EXT2 complex is localized in the Golgi apparatus. Ref.8 |
| Tissue specificity | Ubiquitous. |
| Involvement in disease | Defects in EXT2 are a cause of hereditary multiple exostoses type 2 (EXT2) [MIM:133701]. EXT is a genetically heterogeneous bone disorder caused by genes segregating on human chromosomes 8, 11, and 19 and designated EXT1, EXT2 and EXT3 respectively. EXT is a dominantly inherited skeletal disorder primarily affecting endochondral bone during growth. The disease is characterized by formation of numerous cartilage-capped, benign bone tumors (osteocartilaginous exostoses or osteochondromas) that are often accompanied by skeletal deformities and short stature. In a small percentage of cases exostoses have exhibited malignant transformation resulting in an osteosarcoma or chondrosarcoma. Osteochondromas development can also occur as a sporadic event. Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Defects in EXT2 are the cause of Potocki-Shaffer syndrome (PSS) [MIM:601224]. It is a contiguous gene syndrome due to proximal deletion of chromosome 11p11.2, including EXT2 and ALX4. |
| Sequence similarities | Belongs to the glycosyltransferase 47 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q93063-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q93063-2) The sequence of this isoform differs from the canonical sequence as follows: 392-411: ARWFWEAYFQSIKAIALATL → LFMEPVRRENWSAANHQMNSLIWPREQWDS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 718 | 718 | Exostosin-2 | PRO_0000149651 | |||||
Regions | |||||||||
| Topological domain | 1 – 25 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 26 – 46 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 47 – 718 | 672 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 637 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 392 – 411 | 20 | ARWFW…ALATL → LFMEPVRRENWSAANHQMNS LIWPREQWDS in isoform 2. | VSP_001798 | |||||
| Natural variant | 42 | 1 | M → V. Corresponds to variant rs4755779 [ dbSNP | Ensembl ]. | VAR_033921 | |||||
| Natural variant | 85 | 1 | C → R in EXT2. Ref.13 | VAR_012823 | |||||
| Natural variant | 152 | 1 | L → R in EXT2. Ref.12 | VAR_012824 | |||||
| Natural variant | 179 | 1 | R → S in EXT2. Ref.18 | VAR_012825 | |||||
| Natural variant | 202 | 1 | A → V in EXT2. Ref.15 | VAR_012826 | |||||
| Natural variant | 223 | 1 | R → P in EXT2. Ref.14 | VAR_012827 | |||||
| Natural variant | 227 | 1 | D → N in EXT2; can still form an oligomeric complex. Ref.11 Ref.16 Ref.18 | VAR_002378 | |||||
| Natural variant | 380 | 1 | I → T in EXT2. Ref.17 | VAR_012828 | |||||
| Natural variant | 576 | 1 | E → K in osteochondroma. Ref.17 | VAR_012829 | |||||
Experimental info | |||||||||
| Sequence conflict | 568 | 1 | G → D in AAB62718. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The EXT2 multiple exostoses gene defines a family of putative tumour suppressor genes." Stickens D.J., Clines G., Burbee D.G., Ramos P., Thomas S., Hogue D., Hecht J.T., Lovett M., Evans G.A. Nat. Genet. 14:25-32(1996) [PubMed: 8782816] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Positional cloning of a gene involved in hereditary multiple exostoses." Wuyts W., van Hul W., Wauters J., Nemtsova M., Reyniers E., van Hul E., de Boulle K., de Vries B.B.A., Hendrickx J., Herrygers I., Bossuyt P., Balemans W., Fransen E., Vits L., Coucke P., Nowak N.J., Mallet L., van den Ouweland A.M.W. Willems P.J.Hum. Mol. Genet. 5:1547-1557(1996) [PubMed: 8894688] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The structure of the human multiple exostoses 2 gene and characterization of homologs in mouse and Caenorhabditis elegans." Clines G.A., Ashley J.A., Shah S., Lovett M. Genome Res. 7:359-367(1997) [PubMed: 9110175] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "Molecular cloning of a candidate gene for hereditary multiple exostoses type II." Deng H.-X., Fan C., Xia J.H., Xu L., He X.X., Ruan Q.G., Yang Y., Huang L. Prog. Nat. Sci. 6:692-699(1996) Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Amygdala. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Ovary. |
| [8] | "Association of EXT1 and EXT2, hereditary multiple exostoses gene products, in Golgi apparatus." Kobayashi S., Morimoto K., Shimizu T., Takahashi M., Kurosawa H., Shirasawa T. Biochem. Biophys. Res. Commun. 268:860-867(2000) [PubMed: 10679296] [Abstract] Cited for: SUBUNIT, SUBCELLULAR LOCATION. |
| [9] | "A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses." Simmons A.D., Musy M.M., Lopes C.S., Hwang L.-Y., Yang Y.-P., Lovett M. Hum. Mol. Genet. 8:2155-2164(1999) [PubMed: 10545594] [Abstract] Cited for: INTERACTION WITH GALNT5. |
| [10] | "Molecular basis of multiple exostoses: mutations in the EXT1 and EXT2 genes." Wuyts W., Van Hul W. Hum. Mutat. 15:220-227(2000) [PubMed: 10679937] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [11] | "Mutation screening of the EXT1 and EXT2 genes in patients with hereditary multiple exostoses." Philippe C., Porter D.E., Emerton M.E., Wells D.E., Simpson A.H.R.W., Monaco A.P. Am. J. Hum. Genet. 61:520-528(1997) [PubMed: 9326317] [Abstract] Cited for: VARIANT EXT2 ASN-227. |
| [12] | "Mutation analysis of hereditary multiple exostoses in the Chinese." Xu L., Xia J., Jiang H., Zhou J., Li H., Wang D., Pan Q., Long Z., Fan C., Deng H.-X. Hum. Genet. 105:45-50(1999) [PubMed: 10480354] [Abstract] Cited for: VARIANT EXT2 ARG-152, ALTERNATIVE SPLICING. |
| [13] | "Germline mutations in the EXT1 and EXT2 genes in Korean patients with hereditary multiple exostoses." Park K.J., Shin K.-H., Ku J.-L., Cho T.-J., Lee S.H., Choi I.H., Philippe C., Monaco A.P., Porter D.E., Park J.-G. J. Hum. Genet. 44:230-234(1999) [PubMed: 10429361] [Abstract] Cited for: VARIANT EXT2 ARG-85. |
| [14] | "An R223P mutation in EXT2 gene causes hereditary multiple exostoses." Shi Y.-R., Wu J.-Y., Tsai F.-J., Lee C.-C., Tsai C.-H. Hum. Mutat. 15:390-391(2000) [PubMed: 10738008] [Abstract] Cited for: VARIANT EXT2 PRO-223. |
| [15] | "Mutation frequencies of EXT1 and EXT2 in 43 Japanese families with hereditary multiple exostoses." Seki H., Kubota T., Ikegawa S., Haga N., Fujioka F., Ohzeki S., Wakui K., Yoshikawa H., Takaoka K., Fukushima Y. Am. J. Med. Genet. 99:59-62(2001) [PubMed: 11170095] [Abstract] Cited for: VARIANT EXT2 VAL-202. |
| [16] | "Diminished levels of the putative tumor suppressor proteins EXT1 and EXT2 in exostosis chondrocytes." Bernard M.A., Hall C.E., Hogue D.A., Cole W.G., Scott A., Snuggs M.B., Clines G.A., Luedecke H.-J., Lovett M., Van Winkle W.B., Hecht J.T. Cell Motil. Cytoskeleton 48:149-162(2001) [PubMed: 11169766] [Abstract] Cited for: VARIANT EXT2 ASN-227. |
| [17] | "Ext-mutation analysis in Italian sporadic and hereditary osteochondromas." Gigante M., Matera M.G., Seripa D., Izzo A.M., Venanzi R., Giannotti A., Digilio M.C., Gravina C., Lazzari M., Monteleone G., Monteleone M., Dallapiccola B., Fazio V.M. Int. J. Cancer 95:378-383(2001) [PubMed: 11668521] [Abstract] Cited for: VARIANT EXT2 THR-380, VARIANT OSTEOCHONDROMA LYS-576. |
| [18] | "Genotype-phenotype correlation in hereditary multiple exostoses." Francannet C., Cohen-Tanugi A., Le Merrer M., Munnich A., Bonaventure J., Legeai-Mallet L. J. Med. Genet. 38:430-434(2001) [PubMed: 11432960] [Abstract] Cited for: VARIANTS EXT2 SER-179 AND ASN-227. |
| + | Additional computationally mapped references. |
Web resources
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
| GeneReviews |
| GGDB GlycoGene database |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U62740 mRNA. Translation: AAB07008.1. U64511 mRNA. Translation: AAC50764.1. U67368 U67367 Genomic DNA. Translation: AAC51219.1.U72263 mRNA. Translation: AAB62718.1. AK312375 mRNA. Translation: BAG35293.1. CH471064 Genomic DNA. Translation: EAW68068.1. BC010058 mRNA. Translation: AAH10058.1. |
| IPI | IPI00004047. IPI00942173. |
| RefSeq | NP_001171554.1. NM_001178083.1. NP_997005.1. NM_207122.1. |
| UniGene | Hs.368404. |
3D structure databases | |
| ProteinModelPortal | Q93063. |
| SMR | Q93063. Positions 454-709. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q93063. 3 interactions. |
| STRING | Q93063. |
Protein family/group databases | |
| CAZy | GT47. Glycosyltransferase Family 47. GT64. Glycosyltransferase Family 64. |
Polymorphism databases | |
| DMDM | 3023739. |
Proteomic databases | |
| PRIDE | Q93063. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000343631; ENSP00000342656; ENSG00000151348. ENST00000395673; ENSP00000379032; ENSG00000151348. |
| GeneID | 2132. |
| KEGG | hsa:2132. |
| UCSC | uc001mxz.1. human. uc009ykt.1. human. |
Organism-specific databases | |
| CTD | 2132. |
| GeneCards | GC11P044117. |
| H-InvDB | HIX0009575. |
| HGNC | HGNC:3513. EXT2. |
| MIM | 133701. phenotype. 601224. phenotype. 608210. gene. |
| neXtProt | NX_Q93063. |
| Orphanet | 321. Multiple osteochondromas. 52022. Potocki-Shaffer syndrome. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13563. |
| GeneTree | ENSGT00550000074496. |
| HOGENOM | HBG713745. |
| HOVERGEN | HBG101211. |
| OrthoDB | EOG41VK2B. |
| PhylomeDB | Q93063. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS07726-MONOMER. |
Gene expression databases | |
| ArrayExpress | Q93063. |
| Bgee | Q93063. |
| CleanEx | HS_EXT2. |
| Genevestigator | Q93063. |
| GermOnline | ENSG00000151348. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004263. Exostosin. IPR015338. HexNAc_Trfase_a. [Graphical view] |
| KO | K02367. |
| Pfam | PF03016. Exostosin. 1 hit. PF09258. Glyco_transf_64. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 8615. |
| SOURCE | Search... |
Entry information
| Entry name | EXT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93063 Secondary accession number(s): B2R5Z6, O15288 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with