Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein with multiple splicing

Gene

RBPMS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.1 Publication

GO - Molecular functioni

  1. nucleotide binding Source: InterPro
  2. poly(A) binding Source: UniProtKB
  3. poly(A) RNA binding Source: UniProtKB
  4. transcription coactivator activity Source: UniProtKB

GO - Biological processi

  1. positive regulation of pathway-restricted SMAD protein phosphorylation Source: UniProtKB
  2. positive regulation of SMAD protein import into nucleus Source: UniProtKB
  3. regulation of transcription, DNA-templated Source: UniProtKB-KW
  4. RNA processing Source: ProtInc
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
Gene namesi
Name:RBPMS
Synonyms:HERMES
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:19097. RBPMS.

Subcellular locationi

  1. Nucleus 1 Publication
  2. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134985584.

Polymorphism and mutation databases

DMDMi13124469.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 196196RNA-binding protein with multiple splicingPRO_0000081793Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei113 – 1131Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93062.
PaxDbiQ93062.
PRIDEiQ93062.

Expressioni

Tissue specificityi

Ubiquitously expressed, at various levels depending on the isoform and the tissue.

Gene expression databases

BgeeiQ93062.
CleanExiHS_RBPMS.
ExpressionAtlasiQ93062. baseline and differential.
GenevestigatoriQ93062.

Organism-specific databases

HPAiHPA056999.

Interactioni

Subunit structurei

Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
P095653EBI-740322,EBI-10196507
ADAM15Q134443EBI-740322,EBI-77818
AESQ081173EBI-740322,EBI-717810
AMMECR1Q9Y4X03EBI-740322,EBI-8583355
APLNB2R5503EBI-740322,EBI-10175488
ARID5AC9J1Q03EBI-740322,EBI-10176351
ATXN1P542536EBI-740322,EBI-930964
BANPQ8N9N53EBI-740322,EBI-744695
BBS2Q9BXC93EBI-740322,EBI-748297
BCL6BA8KA133EBI-740322,EBI-10174813
BHLHE40O145033EBI-740322,EBI-711810
BOLLQ8N9W63EBI-740322,EBI-998198
C11orf87Q6NUJ23EBI-740322,EBI-6660291
C14orf182A1A4T83EBI-740322,EBI-10171684
C1orf111Q5T0L33EBI-740322,EBI-750105
C1orf94Q6P1W54EBI-740322,EBI-946029
C20orf195Q9BVV23EBI-740322,EBI-744935
C22orf39Q6P5X53EBI-740322,EBI-7317823
CAMK2BQ135543EBI-740322,EBI-1058722
CCNG1P519593EBI-740322,EBI-3905829
CCNKO759094EBI-740322,EBI-739806
CDC23Q9UJX24EBI-740322,EBI-396137
CRBNQ96SW23EBI-740322,EBI-2510250
CREB5Q02930-33EBI-740322,EBI-10192698
CRYBA1P058133EBI-740322,EBI-7043337
CSN3P074983EBI-740322,EBI-2602175
DAZAP2Q150386EBI-740322,EBI-724310
DCAF8Q5TAQ93EBI-740322,EBI-740686
DCDC2BA2VCK23EBI-740322,EBI-10173222
DCTN5Q9BTE13EBI-740322,EBI-747324
DMRT3Q9NQL93EBI-740322,EBI-9679045
DOK3Q7L5913EBI-740322,EBI-2834978
DOK6Q6PKX43EBI-740322,EBI-2880244
DPYSL4O145313EBI-740322,EBI-719542
DTX2Q4ZH493EBI-740322,EBI-10192429
DTX2Q86UW94EBI-740322,EBI-740376
EFEMP2O959673EBI-740322,EBI-743414
FAM124BQ9H5Z63EBI-740322,EBI-741626
FAM168AQ925675EBI-740322,EBI-7957930
FBF1Q8TES7-63EBI-740322,EBI-10244131
FBXL18Q96D163EBI-740322,EBI-744419
FOXC2Q999583EBI-740322,EBI-3956892
FOXP3Q9BZS14EBI-740322,EBI-983719
GCM2O756033EBI-740322,EBI-10188645
GLYCTKQ8IVS83EBI-740322,EBI-748515
GPATCH2LQ9NWQ43EBI-740322,EBI-5666657
GPS2Q132273EBI-740322,EBI-713355
GRAPQ135883EBI-740322,EBI-2847510
hCG_20425B4DNA43EBI-740322,EBI-7399002
HEY2Q9UBP53EBI-740322,EBI-750630
HEYLQ9NQ874EBI-740322,EBI-751092
HNRNPLLQ8WVV93EBI-740322,EBI-535849
HOXA1P496393EBI-740322,EBI-740785
Hoxa1P090223EBI-740322,EBI-3957603From a different organism.
IGF2P013443EBI-740322,EBI-7178764
ILF3Q9NXX03EBI-740322,EBI-743980
INCA1Q0VD863EBI-740322,EBI-6509505
INIPQ9NRY23EBI-740322,EBI-2881520
IP6K2Q9UHH93EBI-740322,EBI-747509
KCTD9Q7L2733EBI-740322,EBI-4397613
KIAA1305Q96HR43EBI-740322,EBI-10288524
KIR2DL4Q997063EBI-740322,EBI-10294579
KPNA2Q6NVW73EBI-740322,EBI-9377406
KRTAP12-2P599913EBI-740322,EBI-10176379
KRTAP19-5Q3LI724EBI-740322,EBI-1048945
KRTAP19-7Q3SYF93EBI-740322,EBI-10241353
KRTAP23-1A1A5803EBI-740322,EBI-10171734
KRTAP8-1Q8IUC23EBI-740322,EBI-10261141
LGALS9CQ6DKI23EBI-740322,EBI-9088829
LINC00482Q8N8I63EBI-740322,EBI-10267998
LINC00588Q9Y4M83EBI-740322,EBI-10039207
LMO4P619683EBI-740322,EBI-2798728
LONRF1Q17RB83EBI-740322,EBI-2341787
LRRC75A-AS1Q8N1F13EBI-740322,EBI-2872544
MAGED1Q9Y5V33EBI-740322,EBI-716006
MCM5B1AHB03EBI-740322,EBI-10175425
MYOZ2Q9NPC63EBI-740322,EBI-746712
NAPRTQ6XQN63EBI-740322,EBI-10254872
NAPRTQ6XQN6-23EBI-740322,EBI-10254820
NEDD9Q145113EBI-740322,EBI-2108053
NR1D2Q6NSM03EBI-740322,EBI-10250949
OTX1P322424EBI-740322,EBI-740446
PAPD4Q6PIY73EBI-740322,EBI-2802204
PER1J3QSH93EBI-740322,EBI-10178671
PER1Q6IN513EBI-740322,EBI-10250187
PHF1O431894EBI-740322,EBI-530034
PIH1D1Q9NWS03EBI-740322,EBI-357318
PIN1Q135264EBI-740322,EBI-714158
PITX1P783374EBI-740322,EBI-748265
PLAC8Q96EJ43EBI-740322,EBI-750454
POGZQ7Z3K33EBI-740322,EBI-1389308
POM121Q96HA14EBI-740322,EBI-739990
PRKAA1Q131313EBI-740322,EBI-1181405
PRKAA2P546463EBI-740322,EBI-1383852
PRR20CP864793EBI-740322,EBI-10172814
QKIQ96PU85EBI-740322,EBI-945792
R3HDM2Q9Y2K5-23EBI-740322,EBI-10326419
RBFOX1Q9NWB13EBI-740322,EBI-945906
RDH12Q96NR83EBI-740322,EBI-3916363
RHOBTB3O949553EBI-740322,EBI-2367123
RHOXF2Q9BQY46EBI-740322,EBI-372094
RIPPLY1Q0D2K33EBI-740322,EBI-10226430
ROR2A1L4F53EBI-740322,EBI-10172778
RTP5Q14D333EBI-740322,EBI-10217913
RUSC1Q9BVN23EBI-740322,EBI-6257312
SBF2Q86WG53EBI-740322,EBI-2683289
SEMA4GQ9NTN9-33EBI-740322,EBI-9089805
SH3RF2Q08AM83EBI-740322,EBI-10225873
SIRPB1O00241-23EBI-740322,EBI-10179231
SMRP1Q8NCR63EBI-740322,EBI-10269322
SMUG1Q53HV72EBI-740322,EBI-749970
SNRPBP14678-23EBI-740322,EBI-372475
SNRPCQ5TAL43EBI-740322,EBI-10246938
SPATA8Q6RVD64EBI-740322,EBI-8635958
SPG7Q9UQ903EBI-740322,EBI-717201
STRBPQ96SI94EBI-740322,EBI-740355
TBX6O959473EBI-740322,EBI-2824328
TEX37Q96LM64EBI-740322,EBI-743976
TFGQ927343EBI-740322,EBI-357061
TIE1P355903EBI-740322,EBI-2256865
TINAGL1Q9GZM7-33EBI-740322,EBI-10303636
TMSB4XQ0P5Q03EBI-740322,EBI-10226570
TOLLIPQ6FIE93EBI-740322,EBI-10249783
TOLLIPQ9H0E24EBI-740322,EBI-74615
TOR1AIP2Q9H4963EBI-740322,EBI-2510146
TTLL10Q6ZVT03EBI-740322,EBI-7844656
TUSC2O758963EBI-740322,EBI-1052725
VENTXO952313EBI-740322,EBI-10191303
VHLLQ6RSH73EBI-740322,EBI-10254232
VPS37CA5D8V63EBI-740322,EBI-2559305
WDR90Q96KV73EBI-740322,EBI-9478492
WDYHV1Q96HA83EBI-740322,EBI-741158
ZC3H10Q96K804EBI-740322,EBI-742550
ZNF385CQ66K413EBI-740322,EBI-10219231
ZNF488Q96MN93EBI-740322,EBI-948288
ZNF581Q9P0T44EBI-740322,EBI-745520

Protein-protein interaction databases

BioGridi116220. 180 interactions.
IntActiQ93062. 174 interactions.
MINTiMINT-1434067.
STRINGi9606.ENSP00000340176.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortaliQ93062.
SMRiQ93062. Positions 22-103.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 10178RRMPROSITE-ProRule annotationAdd
BLAST

Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity.

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG292253.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ93062.
OMAiFVTYQPP.
OrthoDBiEOG7ZSHT9.
PhylomeDBiQ93062.
TreeFamiTF351070.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform A (identifier: Q93062-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNNGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY
60 70 80 90 100
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK
110 120 130 140 150
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP
160 170 180 190
YPLYPAELAP ALPPPAFTYP ASLHAQMRWL PPSEATSQGW KSRQFC

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:196
Mass (Da):21,802
Last modified:February 1, 1997 - v1
Checksum:i05DD964E62F8F88C
GO
Isoform B (identifier: Q93062-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV

Show »
Length:204
Mass (Da):22,416
Checksum:i60382A7EC1D4672F
GO
Isoform C (identifier: Q93062-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:219
Mass (Da):24,277
Checksum:i700E9B9FA7682FAD
GO
Isoform D (identifier: Q93062-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ

Show »
Length:143
Mass (Da):15,794
Checksum:i86DDB14345784716
GO
Isoform E (identifier: Q93062-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-176: Missing.

Show »
Length:152
Mass (Da):17,022
Checksum:iB62DC25BB6EFB888
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei133 – 19664YELTV…SRQFC → LGGANEHGERQ in isoform D. 1 PublicationVSP_005815Add
BLAST
Alternative sequencei133 – 17644Missing in isoform E. 1 PublicationVSP_005816Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. 1 PublicationVSP_005813Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. 2 PublicationsVSP_005814Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSiCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRiJC6127.
RefSeqiNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
UniGeneiHs.334587.

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneIDi11030.
KEGGihsa:11030.
UCSCiuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSiCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRiJC6127.
RefSeqiNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
UniGeneiHs.334587.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortaliQ93062.
SMRiQ93062. Positions 22-103.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116220. 180 interactions.
IntActiQ93062. 174 interactions.
MINTiMINT-1434067.
STRINGi9606.ENSP00000340176.

Polymorphism and mutation databases

DMDMi13124469.

Proteomic databases

MaxQBiQ93062.
PaxDbiQ93062.
PRIDEiQ93062.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneIDi11030.
KEGGihsa:11030.
UCSCiuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Organism-specific databases

CTDi11030.
GeneCardsiGC08P030242.
HGNCiHGNC:19097. RBPMS.
HPAiHPA056999.
MIMi601558. gene.
neXtProtiNX_Q93062.
PharmGKBiPA134985584.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG292253.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ93062.
OMAiFVTYQPP.
OrthoDBiEOG7ZSHT9.
PhylomeDBiQ93062.
TreeFamiTF351070.

Miscellaneous databases

ChiTaRSiRBPMS. human.
GeneWikiiRBPMS.
GenomeRNAii11030.
NextBioi41912.
PROiQ93062.
SOURCEiSearch...

Gene expression databases

BgeeiQ93062.
CleanExiHS_RBPMS.
ExpressionAtlasiQ93062. baseline and differential.
GenevestigatoriQ93062.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs."
    Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y.
    Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E).
    Tissue: Lip.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
    Tissue: Placenta.
  4. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  5. "Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS."
    Sun Y., Ding L., Zhang H., Han J., Yang X., Yan J., Zhu Y., Li J., Song H., Ye Q.
    Nucleic Acids Res. 34:6314-6326(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SMAD2; SMAD3; SMAD4 AND TGFBR1, SUBCELLULAR LOCATION, RNA-BINDING.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRBPMS_HUMAN
AccessioniPrimary (citable) accession number: Q93062
Secondary accession number(s): D3DSU9
, Q92516, Q92517, Q92518, Q96J26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 1, 1997
Last modified: April 29, 2015
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.