Q93062 (RBPMS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RNA-binding protein with multiple splicing Short name=RBP-MS Alternative name(s): Heart and RRM expressed sequence Short name=Hermes | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 196 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA. Ref.5 |
| Subunit structure | Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct. Ref.5 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed, at various levels depending on the isoform and the tissue. |
| Domain | The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity. |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 3 | EBI-740322,EBI-930964 | |
| QKI | Q96PU8 | 2 | EBI-740322,EBI-945792 | |
| SMUG1 | Q53HV7 | 2 | EBI-740322,EBI-749970 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform A (identifier: Q93062-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform B (identifier: Q93062-2) The sequence of this isoform differs from the canonical sequence as follows: 177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV | ||||||
| Isoform C (identifier: Q93062-3) The sequence of this isoform differs from the canonical sequence as follows: 177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC | ||||||
| Isoform D (identifier: Q93062-4) The sequence of this isoform differs from the canonical sequence as follows: 133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ | ||||||
| Isoform E (identifier: Q93062-5) The sequence of this isoform differs from the canonical sequence as follows: 133-176: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 196 | 196 | RNA-binding protein with multiple splicing | PRO_0000081793 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 24 – 101 | 78 | RRM | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 113 | 1 | Phosphothreonine Ref.6 | |||||||||||||||||||||||
| Modified residue | 118 | 1 | Phosphothreonine Ref.6 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 133 – 196 | 64 | YELTV…SRQFC → LGGANEHGERQ in isoform D. | VSP_005815 | ||||||||||||||||||||||
| Alternative sequence | 133 – 176 | 44 | Missing in isoform E. | VSP_005816 | ||||||||||||||||||||||
| Alternative sequence | 177 – 196 | 20 | MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. | VSP_005813 | ||||||||||||||||||||||
| Alternative sequence | 177 – 196 | 20 | MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. | VSP_005814 | ||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 24 – 29 | 6 | ||||||||||||||||||||||||
| Helix | 40 – 47 | 8 | ||||||||||||||||||||||||
| Turn | 48 – 50 | 3 | ||||||||||||||||||||||||
| Beta strand | 53 – 57 | 5 | ||||||||||||||||||||||||
| Beta strand | 60 – 62 | 3 | ||||||||||||||||||||||||
| Beta strand | 65 – 70 | 6 | ||||||||||||||||||||||||
| Helix | 72 – 81 | 10 | ||||||||||||||||||||||||
| Beta strand | 92 – 95 | 4 | ||||||||||||||||||||||||
| Helix | 101 – 104 | 4 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs." Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y. Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1996) [PubMed: 8855282] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E). Tissue: Lip. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Tissue: Placenta. |
| [4] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [5] | "Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS." Sun Y., Ding L., Zhang H., Han J., Yang X., Yan J., Zhu Y., Li J., Song H., Ye Q. Nucleic Acids Res. 34:6314-6326(2006) [PubMed: 17099224] [Abstract] Cited for: FUNCTION, INTERACTION WITH SMAD2; SMAD3; SMAD4 AND TGFBR1, SUBCELLULAR LOCATION, RNA-BINDING. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113 AND THR-118, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D84110 mRNA. Translation: BAA12228.1. D84107 mRNA. Translation: BAA12225.1. D84108 mRNA. Translation: BAA12226.1. D84109 mRNA. Translation: BAA12227.1. D84111 mRNA. Translation: BAA12229.1. CH471080 Genomic DNA. Translation: EAW63451.1. CH471080 Genomic DNA. Translation: EAW63453.1. BC003608 mRNA. Translation: AAH03608.1. | ||||||||||||
| IPI | IPI00004045. IPI00101800. IPI00216935. IPI00216936. IPI00414709. | ||||||||||||
| PIR | JC6127. | ||||||||||||
| RefSeq | NP_001008710.1. NM_001008710.1. NP_001008711.1. NM_001008711.1. NP_001008712.1. NM_001008712.1. NP_006858.1. NM_006867.2. | ||||||||||||
| UniGene | Hs.334587. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q93062. | ||||||||||||
| SMR | Q93062. Positions 16-103. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q93062. 57 interactions. | ||||||||||||
| MINT | MINT-1434067. | ||||||||||||
| STRING | Q93062. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 13124469. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q93062. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000320203; ENSP00000318102; ENSG00000157110. ENST00000397323; ENSP00000380486; ENSG00000157110. | ||||||||||||
| GeneID | 11030. | ||||||||||||
| KEGG | hsa:11030. | ||||||||||||
| UCSC | uc003xib.1. human. uc003xic.1. human. uc003xid.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11030. | ||||||||||||
| GeneCards | GC08P030242. | ||||||||||||
| H-InvDB | HIX0007433. | ||||||||||||
| HGNC | HGNC:19097. RBPMS. | ||||||||||||
| MIM | 601558. gene. | ||||||||||||
| neXtProt | NX_Q93062. | ||||||||||||
| PharmGKB | PA134985584. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00500000044861. | ||||||||||||
| HOVERGEN | HBG069897. | ||||||||||||
| OMA | FVTYQPP. | ||||||||||||
| OrthoDB | EOG4NGGNV. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q93062. | ||||||||||||
| Bgee | Q93062. | ||||||||||||
| CleanEx | HS_RBPMS. | ||||||||||||
| Genevestigator | Q93062. | ||||||||||||
| GermOnline | ENSG00000157110. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. | ||||||||||||
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 41912. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBPMS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93062 Secondary accession number(s): D3DSU9 Q96J26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with