Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q93062 (RBPMS_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 134. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RNA-binding protein with multiple splicing

Short name=RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name=Hermes
Gene names
Name:RBPMS
Synonyms:HERMES
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length196 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA. Ref.5

Subunit structure

Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct. Ref.5

Subcellular location

Nucleus. Cytoplasm Ref.5.

Tissue specificity

Ubiquitously expressed, at various levels depending on the isoform andthe tissue.

Domain

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity.

Sequence similarities

Contains 1 RRM (RNA recognition motif) domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

ATXN1P542533EBI-740322,EBI-930964
Hoxa1P090223EBI-740322,EBI-3957603From a different organism.
QKIQ96PU82EBI-740322,EBI-945792
SMUG1Q53HV72EBI-740322,EBI-749970

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform A (identifier: Q93062-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform B (identifier: Q93062-2)

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV
Isoform C (identifier: Q93062-3)

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC
Isoform D (identifier: Q93062-4)

The sequence of this isoform differs from the canonical sequence as follows:
     133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ
Isoform E (identifier: Q93062-5)

The sequence of this isoform differs from the canonical sequence as follows:
     133-176: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 196196RNA-binding protein with multiple splicing
PRO_0000081793

Regions

Domain24 – 10178RRM

Amino acid modifications

Modified residue11N-acetylmethionine Ref.7
Modified residue1131Phosphothreonine Ref.6

Natural variations

Alternative sequence133 – 19664YELTV…SRQFC → LGGANEHGERQ in isoform D.
VSP_005815
Alternative sequence133 – 17644Missing in isoform E.
VSP_005816
Alternative sequence177 – 19620MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B.
VSP_005813
Alternative sequence177 – 19620MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C.
VSP_005814

Secondary structure

.................. 196
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified February 1, 1997. Version 1.
Checksum: 05DD964E62F8F88C

FASTA19621,802
        10         20         30         40         50         60 
MNNGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY EGSLIKLTSK 

        70         80         90        100        110        120 
QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK ANTKMAKNKL VGTPNPSTPL 

       130        140        150        160        170        180 
PNTVPQFIAR EPYELTVPAL YPSSPEVWAP YPLYPAELAP ALPPPAFTYP ASLHAQMRWL 

       190 
PPSEATSQGW KSRQFC 

« Hide

Isoform B [UniParc].

Checksum: 60382A7EC1D4672F
Show »

FASTA20422,416
Isoform C [UniParc].

Checksum: 700E9B9FA7682FAD
Show »

FASTA21924,277
Isoform D [UniParc].

Checksum: 86DDB14345784716
Show »

FASTA14315,794
Isoform E [UniParc].

Checksum: B62DC25BB6EFB888
Show »

FASTA15217,022

References

« Hide 'large scale' references
[1]"A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs."
Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y.
Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E).
Tissue: Lip.
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
Tissue: Placenta.
[4]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
[5]"Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS."
Sun Y., Ding L., Zhang H., Han J., Yang X., Yan J., Zhu Y., Li J., Song H., Ye Q.
Nucleic Acids Res. 34:6314-6326(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH SMAD2; SMAD3; SMAD4 AND TGFBR1, SUBCELLULAR LOCATION, RNA-BINDING.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRJC6127.
RefSeqNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
XP_006716341.1. XM_006716278.1. [Q93062-1]
UniGeneHs.334587.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortalQ93062.
SMRQ93062. Positions 20-99.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116220. 52 interactions.
IntActQ93062. 60 interactions.
MINTMINT-1434067.
STRING9606.ENSP00000340176.

Polymorphism databases

DMDM13124469.

Proteomic databases

MaxQBQ93062.
PaxDbQ93062.
PRIDEQ93062.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneID11030.
KEGGhsa:11030.
UCSCuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Organism-specific databases

CTD11030.
GeneCardsGC08P030242.
HGNCHGNC:19097. RBPMS.
HPAHPA056999.
MIM601558. gene.
neXtProtNX_Q93062.
PharmGKBPA134985584.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG292253.
HOGENOMHOG000017369.
HOVERGENHBG069897.
OMAFVTYQPP.
OrthoDBEOG7ZSHT9.
PhylomeDBQ93062.
TreeFamTF351070.

Gene expression databases

ArrayExpressQ93062.
BgeeQ93062.
CleanExHS_RBPMS.
GenevestigatorQ93062.

Family and domain databases

Gene3D3.30.70.330. 1 hit.
InterProIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTSM00360. RRM. 1 hit.
[Graphical view]
PROSITEPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRBPMS. human.
GeneWikiRBPMS.
GenomeRNAi11030.
NextBio41912.
PROQ93062.
SOURCESearch...

Entry information

Entry nameRBPMS_HUMAN
AccessionPrimary (citable) accession number: Q93062
Secondary accession number(s): D3DSU9 expand/collapse secondary AC list , Q92516, Q92517, Q92518, Q96J26
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 1, 1997
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM