Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein with multiple splicing

Gene

RBPMS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.1 Publication

GO - Molecular functioni

  1. nucleotide binding Source: InterPro
  2. poly(A) binding Source: UniProtKB
  3. poly(A) RNA binding Source: UniProtKB
  4. transcription coactivator activity Source: UniProtKB

GO - Biological processi

  1. positive regulation of pathway-restricted SMAD protein phosphorylation Source: UniProtKB
  2. positive regulation of SMAD protein import into nucleus Source: UniProtKB
  3. regulation of transcription, DNA-templated Source: UniProtKB-KW
  4. RNA processing Source: ProtInc
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
Gene namesi
Name:RBPMS
Synonyms:HERMES
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:19097. RBPMS.

Subcellular locationi

Nucleus 1 Publication. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134985584.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 196196RNA-binding protein with multiple splicingPRO_0000081793Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei113 – 1131Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93062.
PaxDbiQ93062.
PRIDEiQ93062.

Expressioni

Tissue specificityi

Ubiquitously expressed, at various levels depending on the isoform and the tissue.

Gene expression databases

BgeeiQ93062.
CleanExiHS_RBPMS.
ExpressionAtlasiQ93062. baseline and differential.
GenevestigatoriQ93062.

Organism-specific databases

HPAiHPA056999.

Interactioni

Subunit structurei

Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542533EBI-740322,EBI-930964
Hoxa1P090223EBI-740322,EBI-3957603From a different organism.
QKIQ96PU82EBI-740322,EBI-945792
SMUG1Q53HV72EBI-740322,EBI-749970

Protein-protein interaction databases

BioGridi116220. 179 interactions.
IntActiQ93062. 61 interactions.
MINTiMINT-1434067.
STRINGi9606.ENSP00000340176.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortaliQ93062.
SMRiQ93062. Positions 22-103.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 10178RRMPROSITE-ProRule annotationAdd
BLAST

Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity.

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG292253.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ93062.
OMAiFVTYQPP.
OrthoDBiEOG7ZSHT9.
PhylomeDBiQ93062.
TreeFamiTF351070.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform A (identifier: Q93062-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNNGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY
60 70 80 90 100
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK
110 120 130 140 150
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP
160 170 180 190
YPLYPAELAP ALPPPAFTYP ASLHAQMRWL PPSEATSQGW KSRQFC

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:196
Mass (Da):21,802
Last modified:February 1, 1997 - v1
Checksum:i05DD964E62F8F88C
GO
Isoform B (identifier: Q93062-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV

Show »
Length:204
Mass (Da):22,416
Checksum:i60382A7EC1D4672F
GO
Isoform C (identifier: Q93062-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:219
Mass (Da):24,277
Checksum:i700E9B9FA7682FAD
GO
Isoform D (identifier: Q93062-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ

Show »
Length:143
Mass (Da):15,794
Checksum:i86DDB14345784716
GO
Isoform E (identifier: Q93062-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-176: Missing.

Show »
Length:152
Mass (Da):17,022
Checksum:iB62DC25BB6EFB888
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei133 – 19664YELTV…SRQFC → LGGANEHGERQ in isoform D. 1 PublicationVSP_005815Add
BLAST
Alternative sequencei133 – 17644Missing in isoform E. 1 PublicationVSP_005816Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. 1 PublicationVSP_005813Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. 2 PublicationsVSP_005814Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSiCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRiJC6127.
RefSeqiNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
XP_006716341.1. XM_006716278.1. [Q93062-1]
UniGeneiHs.334587.

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneIDi11030.
KEGGihsa:11030.
UCSCiuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Polymorphism databases

DMDMi13124469.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSiCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRiJC6127.
RefSeqiNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
XP_006716341.1. XM_006716278.1. [Q93062-1]
UniGeneiHs.334587.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortaliQ93062.
SMRiQ93062. Positions 22-103.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116220. 179 interactions.
IntActiQ93062. 61 interactions.
MINTiMINT-1434067.
STRINGi9606.ENSP00000340176.

Polymorphism databases

DMDMi13124469.

Proteomic databases

MaxQBiQ93062.
PaxDbiQ93062.
PRIDEiQ93062.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneIDi11030.
KEGGihsa:11030.
UCSCiuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Organism-specific databases

CTDi11030.
GeneCardsiGC08P030242.
HGNCiHGNC:19097. RBPMS.
HPAiHPA056999.
MIMi601558. gene.
neXtProtiNX_Q93062.
PharmGKBiPA134985584.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG292253.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ93062.
OMAiFVTYQPP.
OrthoDBiEOG7ZSHT9.
PhylomeDBiQ93062.
TreeFamiTF351070.

Miscellaneous databases

ChiTaRSiRBPMS. human.
GeneWikiiRBPMS.
GenomeRNAii11030.
NextBioi41912.
PROiQ93062.
SOURCEiSearch...

Gene expression databases

BgeeiQ93062.
CleanExiHS_RBPMS.
ExpressionAtlasiQ93062. baseline and differential.
GenevestigatoriQ93062.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs."
    Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y.
    Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E).
    Tissue: Lip.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
    Tissue: Placenta.
  4. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  5. "Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS."
    Sun Y., Ding L., Zhang H., Han J., Yang X., Yan J., Zhu Y., Li J., Song H., Ye Q.
    Nucleic Acids Res. 34:6314-6326(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SMAD2; SMAD3; SMAD4 AND TGFBR1, SUBCELLULAR LOCATION, RNA-BINDING.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRBPMS_HUMAN
AccessioniPrimary (citable) accession number: Q93062
Secondary accession number(s): D3DSU9
, Q92516, Q92517, Q92518, Q96J26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 1, 1997
Last modified: February 4, 2015
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.