Reviewed,
UniProtKB/Swiss-Prot Q93062 (RBPMS_HUMAN)
Last modified
July 7, 2009.
Version 86.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: RNA-binding protein with multiple splicing Short name=RBP-MS | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 196 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May bind RNA. |
| Tissue specificity | Ubiquitously expressed, at various levels depending on the isoform and the tissue. |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | RNA processing Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | RNA binding Ref.1 Traceable author statement. Source: ProtInc nucleotide bindingInferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 1 | EBI-740322,EBI-930964 | |
| QKI | Q96PU8 | 1 | EBI-740322,EBI-945792 | |
| SMUG1 | Q53HV7 | 1 | EBI-740322,EBI-749970 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform A (identifier: Q93062-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform B (identifier: Q93062-2) The sequence of this isoform differs from the canonical sequence as follows: 177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV | ||||||
| Isoform C (identifier: Q93062-3) The sequence of this isoform differs from the canonical sequence as follows: 177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC | ||||||
| Isoform D (identifier: Q93062-4) The sequence of this isoform differs from the canonical sequence as follows: 133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ | ||||||
| Isoform E (identifier: Q93062-5) The sequence of this isoform differs from the canonical sequence as follows: 133-176: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 196 | 196 | RNA-binding protein with multiple splicing | PRO_0000081793 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 24 – 101 | 78 | RRM | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 113 | 1 | Phosphothreonine Ref.4 | |||||||||||||||||||||||
| Modified residue | 118 | 1 | Phosphothreonine Ref.4 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 133 – 196 | 64 | YELTV…SRQFC → LGGANEHGERQ in isoform D. | VSP_005815 | ||||||||||||||||||||||
| Alternative sequence | 133 – 176 | 44 | Missing in isoform E. | VSP_005816 | ||||||||||||||||||||||
| Alternative sequence | 177 – 196 | 20 | MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. | VSP_005813 | ||||||||||||||||||||||
| Alternative sequence | 177 – 196 | 20 | MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. | VSP_005814 | ||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 24 – 29 | 6 | ||||||||||||||||||||||||
| Helix | 40 – 47 | 8 | ||||||||||||||||||||||||
| Turn | 48 – 50 | 3 | ||||||||||||||||||||||||
| Beta strand | 53 – 57 | 5 | ||||||||||||||||||||||||
| Beta strand | 60 – 62 | 3 | ||||||||||||||||||||||||
| Beta strand | 65 – 70 | 6 | ||||||||||||||||||||||||
| Helix | 72 – 81 | 10 | ||||||||||||||||||||||||
| Beta strand | 92 – 95 | 4 | ||||||||||||||||||||||||
| Helix | 101 – 104 | 4 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs." Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y. Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1996) [PubMed: 8855282] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E). Tissue: Lip. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Tissue: Placenta. |
| [3] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113 AND THR-118, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| D84110 mRNA. Translation: BAA12228.1. D84107 mRNA. Translation: BAA12225.1. D84108 mRNA. Translation: BAA12226.1. D84109 mRNA. Translation: BAA12227.1. D84111 mRNA. Translation: BAA12229.1. BC003608 mRNA. Translation: AAH03608.1. | |||||||||||||
| IPI | IPI00004045. IPI00101800. IPI00216935. IPI00216936. IPI00414709. | ||||||||||||
| PIR | JC6127. | ||||||||||||
| RefSeq | NP_001008710.1. NP_001008711.1. NP_001008712.1. NP_006858.1. | ||||||||||||
| UniGene | Hs.334587 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q93062. 49 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q93062. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000157110. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 11030. | ||||||||||||
| KEGG | hsa:11030. | ||||||||||||
| UCSC | uc003xib.1. human. uc003xic.1. human. uc003xid.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC08P030361. | ||||||||||||
| H-InvDB | HIX0007433. | ||||||||||||
| HGNC | HGNC:19097. RBPMS. | ||||||||||||
| MIM | 601558. gene. | ||||||||||||
| PharmGKB | PA134985584. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q93062. | ||||||||||||
| OMA | Q93062. WIPPSEA. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q93062. | ||||||||||||
| Bgee | Q93062. | ||||||||||||
| CleanEx | HS_RBPMS. | ||||||||||||
| GermOnline | ENSG00000157110. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR000504. RRM_RNP1. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. | ||||||||||||
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 41912. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBPMS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93062 Secondary accession number(s): Q92516 Q96J26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


