SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q93062

- RBPMS_HUMAN

UniProt

Q93062 - RBPMS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RNA-binding protein with multiple splicing

Gene
RBPMS, HERMES
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.1 Publication

GO - Molecular functioni

  1. nucleotide binding Source: InterPro
  2. poly(A) binding Source: UniProtKB
  3. poly(A) RNA binding Source: UniProtKB
  4. protein binding Source: UniProtKB
  5. transcription coactivator activity Source: UniProtKB

GO - Biological processi

  1. positive regulation of pathway-restricted SMAD protein phosphorylation Source: UniProtKB
  2. positive regulation of SMAD protein import into nucleus Source: UniProtKB
  3. regulation of transcription, DNA-templated Source: UniProtKB-KW
  4. RNA processing Source: ProtInc
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
Gene namesi
Name:RBPMS
Synonyms:HERMES
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:19097. RBPMS.

Subcellular locationi

Nucleus. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134985584.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 196196RNA-binding protein with multiple splicingPRO_0000081793Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei113 – 1131Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ93062.
PaxDbiQ93062.
PRIDEiQ93062.

Expressioni

Tissue specificityi

Ubiquitously expressed, at various levels depending on the isoform and the tissue.

Gene expression databases

ArrayExpressiQ93062.
BgeeiQ93062.
CleanExiHS_RBPMS.
GenevestigatoriQ93062.

Organism-specific databases

HPAiHPA056999.

Interactioni

Subunit structurei

Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542533EBI-740322,EBI-930964
Hoxa1P090223EBI-740322,EBI-3957603From a different organism.
QKIQ96PU82EBI-740322,EBI-945792
SMUG1Q53HV72EBI-740322,EBI-749970

Protein-protein interaction databases

BioGridi116220. 52 interactions.
IntActiQ93062. 60 interactions.
MINTiMINT-1434067.
STRINGi9606.ENSP00000340176.

Structurei

Secondary structure

1
196
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi24 – 296
Helixi40 – 478
Turni48 – 503
Beta strandi53 – 575
Beta strandi60 – 623
Beta strandi65 – 706
Helixi72 – 8110
Beta strandi92 – 954
Helixi101 – 1044

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
ProteinModelPortaliQ93062.
SMRiQ93062. Positions 20-99.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 10178RRMAdd
BLAST

Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG292253.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
OMAiFVTYQPP.
OrthoDBiEOG7ZSHT9.
PhylomeDBiQ93062.
TreeFamiTF351070.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform A (identifier: Q93062-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNNGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY    50
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK 100
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP 150
YPLYPAELAP ALPPPAFTYP ASLHAQMRWL PPSEATSQGW KSRQFC 196

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:196
Mass (Da):21,802
Last modified:February 1, 1997 - v1
Checksum:i05DD964E62F8F88C
GO
Isoform B (identifier: Q93062-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV

Show »
Length:204
Mass (Da):22,416
Checksum:i60382A7EC1D4672F
GO
Isoform C (identifier: Q93062-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:219
Mass (Da):24,277
Checksum:i700E9B9FA7682FAD
GO
Isoform D (identifier: Q93062-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ

Show »
Length:143
Mass (Da):15,794
Checksum:i86DDB14345784716
GO
Isoform E (identifier: Q93062-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-176: Missing.

Show »
Length:152
Mass (Da):17,022
Checksum:iB62DC25BB6EFB888
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei133 – 19664YELTV…SRQFC → LGGANEHGERQ in isoform D. VSP_005815Add
BLAST
Alternative sequencei133 – 17644Missing in isoform E. VSP_005816Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. VSP_005813Add
BLAST
Alternative sequencei177 – 19620MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. VSP_005814Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D84110 mRNA. Translation: BAA12228.1.
D84107 mRNA. Translation: BAA12225.1.
D84108 mRNA. Translation: BAA12226.1.
D84109 mRNA. Translation: BAA12227.1.
D84111 mRNA. Translation: BAA12229.1.
CH471080 Genomic DNA. Translation: EAW63451.1.
CH471080 Genomic DNA. Translation: EAW63453.1.
BC003608 mRNA. Translation: AAH03608.1.
CCDSiCCDS34875.1. [Q93062-2]
CCDS34876.1. [Q93062-3]
CCDS6077.1. [Q93062-1]
PIRiJC6127.
RefSeqiNP_001008710.1. NM_001008710.2. [Q93062-1]
NP_001008711.1. NM_001008711.2. [Q93062-2]
NP_001008712.1. NM_001008712.2. [Q93062-3]
NP_006858.1. NM_006867.3. [Q93062-1]
XP_006716341.1. XM_006716278.1. [Q93062-1]
UniGeneiHs.334587.

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110. [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110. [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110. [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110. [Q93062-1]
GeneIDi11030.
KEGGihsa:11030.
UCSCiuc003xib.3. human. [Q93062-3]
uc003xic.1. human. [Q93062-1]
uc003xid.1. human. [Q93062-2]

Polymorphism databases

DMDMi13124469.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D84110 mRNA. Translation: BAA12228.1 .
D84107 mRNA. Translation: BAA12225.1 .
D84108 mRNA. Translation: BAA12226.1 .
D84109 mRNA. Translation: BAA12227.1 .
D84111 mRNA. Translation: BAA12229.1 .
CH471080 Genomic DNA. Translation: EAW63451.1 .
CH471080 Genomic DNA. Translation: EAW63453.1 .
BC003608 mRNA. Translation: AAH03608.1 .
CCDSi CCDS34875.1. [Q93062-2 ]
CCDS34876.1. [Q93062-3 ]
CCDS6077.1. [Q93062-1 ]
PIRi JC6127.
RefSeqi NP_001008710.1. NM_001008710.2. [Q93062-1 ]
NP_001008711.1. NM_001008711.2. [Q93062-2 ]
NP_001008712.1. NM_001008712.2. [Q93062-3 ]
NP_006858.1. NM_006867.3. [Q93062-1 ]
XP_006716341.1. XM_006716278.1. [Q93062-1 ]
UniGenei Hs.334587.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1BNY model - A 15-111 [» ]
ProteinModelPortali Q93062.
SMRi Q93062. Positions 20-99.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116220. 52 interactions.
IntActi Q93062. 60 interactions.
MINTi MINT-1434067.
STRINGi 9606.ENSP00000340176.

Polymorphism databases

DMDMi 13124469.

Proteomic databases

MaxQBi Q93062.
PaxDbi Q93062.
PRIDEi Q93062.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000287771 ; ENSP00000287771 ; ENSG00000157110 . [Q93062-2 ]
ENST00000320203 ; ENSP00000318102 ; ENSG00000157110 . [Q93062-1 ]
ENST00000339877 ; ENSP00000340176 ; ENSG00000157110 . [Q93062-3 ]
ENST00000397323 ; ENSP00000380486 ; ENSG00000157110 . [Q93062-1 ]
GeneIDi 11030.
KEGGi hsa:11030.
UCSCi uc003xib.3. human. [Q93062-3 ]
uc003xic.1. human. [Q93062-1 ]
uc003xid.1. human. [Q93062-2 ]

Organism-specific databases

CTDi 11030.
GeneCardsi GC08P030242.
HGNCi HGNC:19097. RBPMS.
HPAi HPA056999.
MIMi 601558. gene.
neXtProti NX_Q93062.
PharmGKBi PA134985584.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG292253.
HOGENOMi HOG000017369.
HOVERGENi HBG069897.
OMAi FVTYQPP.
OrthoDBi EOG7ZSHT9.
PhylomeDBi Q93062.
TreeFami TF351070.

Miscellaneous databases

ChiTaRSi RBPMS. human.
GeneWikii RBPMS.
GenomeRNAii 11030.
NextBioi 41912.
PROi Q93062.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q93062.
Bgeei Q93062.
CleanExi HS_RBPMS.
Genevestigatori Q93062.

Family and domain databases

Gene3Di 3.30.70.330. 1 hit.
InterProi IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view ]
Pfami PF00076. RRM_1. 1 hit.
[Graphical view ]
SMARTi SM00360. RRM. 1 hit.
[Graphical view ]
PROSITEi PS50102. RRM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs."
    Shimamoto A., Kitao S., Ichikawa K., Suzuki N., Yamabe Y., Imamura O., Tokutake Y., Satoh M., Matsumoto T., Kuromitsu J., Kataoka H., Sugawara K., Sugawara M., Sugimoto M., Goto M., Furuichi Y.
    Proc. Natl. Acad. Sci. U.S.A. 93:10913-10917(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E).
    Tissue: Lip.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
    Tissue: Placenta.
  4. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  5. "Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS."
    Sun Y., Ding L., Zhang H., Han J., Yang X., Yan J., Zhu Y., Li J., Song H., Ye Q.
    Nucleic Acids Res. 34:6314-6326(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SMAD2; SMAD3; SMAD4 AND TGFBR1, SUBCELLULAR LOCATION, RNA-BINDING.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-113, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRBPMS_HUMAN
AccessioniPrimary (citable) accession number: Q93062
Secondary accession number(s): D3DSU9
, Q92516, Q92517, Q92518, Q96J26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 1, 1997
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi