Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q93038 (TNR25_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 142. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tumor necrosis factor receptor superfamily member 25
Alternative name(s):
Apo-3
Apoptosis-inducing receptor AIR
Apoptosis-mediating receptor DR3
Apoptosis-mediating receptor TRAMP
Death receptor 3
Lymphocyte-associated receptor of death
Short name=LARD
Protein WSL
Protein WSL-1
Gene names
Name:TNFRSF25
Synonyms:APO3, DDR3, DR3, TNFRSF12, WSL, WSL1
ORF Names:UNQ455/PRO779
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length417 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

Subunit structure

Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4. Ref.14

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein.

Isoform 2: Cell membrane; Single-pass type I membrane protein.

Isoform 9: Cell membrane; Single-pass type I membrane protein.

Isoform 11: Cell membrane; Single-pass type I membrane protein.

Isoform 3: Secreted.

Isoform 4: Secreted.

Isoform 5: Secreted.

Isoform 6: Secreted.

Isoform 7: Secreted.

Isoform 8: Secreted.

Isoform 10: Secreted.

Isoform 12: Secreted.

Tissue specificity

Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.

Post-translational modification

Glycosylated Probable.

Sequence similarities

Contains 1 death domain.

Contains 4 TNFR-Cys repeats.

Alternative products

This entry describes 12 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q93038-1)

Also known as: WSL-1; LARD-1A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q93038-2)

Also known as: LARD-1B;

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: A → AA
Isoform 3 (identifier: Q93038-3)

Also known as: WSL-S1; LARD-3;

The sequence of this isoform differs from the canonical sequence as follows:
     182-218: STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA → VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR
     219-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q93038-4)

Also known as: WSL-S2; LARD-2;

The sequence of this isoform differs from the canonical sequence as follows:
     200-253: MFWVQVLLAG...LTPPPATHLS → SRWCAGNARG...LWSPSCLGPP
     254-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 5 (identifier: Q93038-5)

Also known as: LARD-4; LARD-11;

The sequence of this isoform differs from the canonical sequence as follows:
     182-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 6 (identifier: Q93038-6)

Also known as: LARD-5;

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     182-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 7 (identifier: Q93038-7)

Also known as: LARD-6;

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     156-171: SRRDTDCGTCLPGFYE → HPSVTLGQRPHPSSTS
     172-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 8 (identifier: Q93038-8)

Also known as: LARD-7;

The sequence of this isoform differs from the canonical sequence as follows:
     54-236: Missing.
Isoform 9 (identifier: Q93038-9)

Also known as: LARD-8;

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
Isoform 10 (identifier: Q93038-10)

Also known as: LARD-9;

The sequence of this isoform differs from the canonical sequence as follows:
     200-237: MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD → N
Isoform 11 (identifier: Q93038-11)

Also known as: Beta;

The sequence of this isoform differs from the canonical sequence as follows:
     182-200: STLGSCPERCAAVCGWRQM → PPPSLAGAPWGAVQSAVPLSVAGGRVGV
Isoform 12 (identifier: Q93038-12)

Also known as: Beta soluble;

The sequence of this isoform differs from the canonical sequence as follows:
     182-277: STLGSCPERC...SEKICTVQLV → PPPSLAGAPW...LASQAPGYCR
     278-417: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 417393Tumor necrosis factor receptor superfamily member 25
PRO_0000034606

Regions

Topological domain25 – 199175Extracellular Potential
Transmembrane200 – 22021Helical; Potential
Topological domain221 – 417197Cytoplasmic Potential
Repeat34 – 7138TNFR-Cys 1
Repeat72 – 11544TNFR-Cys 2
Repeat116 – 16348TNFR-Cys 3
Repeat164 – 19229TNFR-Cys 4
Domain332 – 41382Death

Amino acid modifications

Glycosylation671N-linked (GlcNAc...) Potential
Glycosylation1061N-linked (GlcNAc...) Potential
Disulfide bond35 ↔ 47 By similarity
Disulfide bond48 ↔ 61 By similarity
Disulfide bond51 ↔ 70 By similarity
Disulfide bond73 ↔ 89 By similarity
Disulfide bond92 ↔ 107 By similarity
Disulfide bond95 ↔ 115 By similarity
Disulfide bond117 ↔ 130 By similarity
Disulfide bond138 ↔ 155 By similarity
Disulfide bond141 ↔ 162 By similarity
Disulfide bond165 ↔ 176 By similarity
Disulfide bond179 ↔ 191 By similarity
Disulfide bond187 ↔ 195 By similarity

Natural variations

Alternative sequence54 – 236183Missing in isoform 8.
VSP_006492
Alternative sequence54 – 9845Missing in isoform 6, isoform 7 and isoform 9.
VSP_006491
Alternative sequence156 – 17116SRRDT…PGFYE → HPSVTLGQRPHPSSTS in isoform 7.
VSP_006493
Alternative sequence172 – 417246Missing in isoform 7.
VSP_006494
Alternative sequence182 – 417236Missing in isoform 5 and isoform 6.
VSP_006495
Alternative sequence182 – 27796STLGS…TVQLV → PPPSLAGAPWGAVQSAVPLS VAGGRVGGVLGMRVGELGWT EGRRVRRGATTQHPPAAFSV LGPGAPGWPCGPPPAWGHPD LHIPPLLASQAPGYCR in isoform 12.
VSP_006499
Alternative sequence182 – 21837STLGS…LLLGA → VLGPGAPGWPCGPPPAWGHP DLHIPPLLASQAPGYCR in isoform 3.
VSP_006497
Alternative sequence182 – 20019STLGS…GWRQM → PPPSLAGAPWGAVQSAVPLS VAGGRVGV in isoform 11.
VSP_006496
Alternative sequence200 – 25354MFWVQ…ATHLS → SRWCAGNARGRTGMDRGEAG EEGGNHPTPTSCFQCSGSRC SWLALWSPSCLGPP in isoform 4.
VSP_006501
Alternative sequence200 – 23738MFWVQ…LVTAD → N in isoform 10.
VSP_006503
Alternative sequence219 – 417199Missing in isoform 3.
VSP_006498
Alternative sequence2361A → AA in isoform 2.
VSP_006504
Alternative sequence254 – 417164Missing in isoform 4.
VSP_006502
Alternative sequence278 – 417140Missing in isoform 12.
VSP_006500
Natural variant231R → Q. Ref.9
Corresponds to variant rs35771371 [ dbSNP | Ensembl ].
VAR_018826
Natural variant1591D → G. Ref.7 Ref.9
Corresponds to variant rs11800462 [ dbSNP | Ensembl ].
VAR_018827
Natural variant2541P → R. Ref.9
Corresponds to variant rs34529016 [ dbSNP | Ensembl ].
VAR_018828
Natural variant3701R → L.
Corresponds to variant rs1064590 [ dbSNP | Ensembl ].
VAR_011814
Natural variant3811R → H.
Corresponds to variant rs1059333 [ dbSNP | Ensembl ].
VAR_011815

Experimental info

Mutagenesis3541L → A: Suppresses homodimerization, TNFR1 interaction, and apoptosis induction.
Mutagenesis3561L → A: Suppresses homodimerization, and TNFR1 interaction.
Mutagenesis3731D → A: Suppresses homodimerization, and TNFR1 interaction.
Sequence conflict4 – 63RPR → AAA in AAC51192. Ref.12
Sequence conflict4 – 63RPR → AAA in AAC51193. Ref.12
Sequence conflict601P → H in AAB41435. Ref.13
Sequence conflict1671P → L Ref.12
Sequence conflict1671P → L Ref.13
Sequence conflict3121A → R Ref.1
Sequence conflict3121A → R Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (WSL-1) (LARD-1A) [UniParc].

Last modified November 1, 1997. Version 2.
Checksum: 5226319DFDB46706

FASTA41745,385
        10         20         30         40         50         60 
MEQRPRGCAA VAAALLLVLL GARAQGGTRS PRCDCAGDFH KKIGLFCCRG CPAGHYLKAP 

        70         80         90        100        110        120 
CTEPCGNSTC LVCPQDTFLA WENHHNSECA RCQACDEQAS QVALENCSAV ADTRCGCKPG 

       130        140        150        160        170        180 
WFVECQVSQC VSSSPFYCQP CLDCGALHRH TRLLCSRRDT DCGTCLPGFY EHGDGCVSCP 

       190        200        210        220        230        240 
TSTLGSCPER CAAVCGWRQM FWVQVLLAGL VVPLLLGATL TYTYRHCWPH KPLVTADEAG 

       250        260        270        280        290        300 
MEALTPPPAT HLSPLDSAHT LLAPPDSSEK ICTVQLVGNS WTPGYPETQE ALCPQVTWSW 

       310        320        330        340        350        360 
DQLPSRALGP AAAPTLSPES PAGSPAMMLQ PGPQLYDVMD AVPARRWKEF VRTLGLREAE 

       370        380        390        400        410 
IEAVEVEIGR FRDQQYEMLK RWRQQQPAGL GAVYAALERM GLDGCVEDLR SRLQRGP 

« Hide

Isoform 2 (LARD-1B) [UniParc].

Checksum: 54B48F8B35C620E2
Show »

FASTA41845,456
Isoform 3 (WSL-S1) (LARD-3) [UniParc].

Checksum: 9B416919AFA442F6
Show »

FASTA21823,198
Isoform 4 (WSL-S2) (LARD-2) [UniParc].

Checksum: 50A06775B68FC3D7
Show »

FASTA25327,004
Isoform 5 (LARD-4) (LARD-11) [UniParc].

Checksum: 59AAFEDBBB46E369
Show »

FASTA18119,432
Isoform 6 (LARD-5) [UniParc].

Checksum: 6846913006EEE40A
Show »

FASTA13614,439
Isoform 7 (LARD-6) [UniParc].

Checksum: EBAC98D7FB3EDB68
Show »

FASTA12613,349
Isoform 8 (LARD-7) [UniParc].

Checksum: D082A4552EDF7531
Show »

FASTA23425,373
Isoform 9 (LARD-8) [UniParc].

Checksum: D4F87353AB7F40F6
Show »

FASTA37240,391
Isoform 10 (LARD-9) [UniParc].

Checksum: ED19B586ADD947B7
Show »

FASTA38041,193
Isoform 11 (Beta) [UniParc].

Checksum: 292A9B2899F3AE1F
Show »

FASTA42645,928
Isoform 12 (Beta soluble) [UniParc].

Checksum: 3D19F3E847BFC093
Show »

FASTA27729,111

References

« Hide 'large scale' references
[1]"A death-domain-containing receptor that mediates apoptosis."
Kitson J., Raven T., Jiang Y.-P., Goeddel D.V., Giles K.M., Pun K.-T., Grinham C.J., Brown R., Farrow S.N.
Nature 384:372-375(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), MUTAGENESIS.
Tissue: Lymphoid tissue.
[2]"Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95."
Chinnaiyan A.M., O'Rourke K., Yu G.-L., Lyons R.H., Garg M., Duan D.R., Xing L., Gentz R., Ni J., Dixit V.M.
Science 274:990-992(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Umbilical vein endothelial cell.
[3]Degli-Esposti M.A., Din W.S., Cosman D., Smith C.A., Goodwin R.G.
Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[4]"Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa-B."
Marsters S.A., Sheridan J.P., Donahue C.J., Pitti R.M., Gray C.L., Goddard A.D., Bauer K.D., Ashkenazi A.
Curr. Biol. 6:1669-1676(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Heart.
[5]"LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing."
Screaton G.R., Xu X.-N., Olsen A.L., Cowper A.E., Tan R., McMichael A.J., Bell J.I.
Proc. Natl. Acad. Sci. U.S.A. 94:4615-4619(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
[6]"A new death receptor 3 isoform: expression in human lymphoid cell lines and non-Hodgkin's lymphomas."
Warzocha K., Ribeiro P., Charlot C., Renard N., Coiffier B., Salles G.
Biochem. Biophys. Res. Commun. 242:376-379(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 11 AND 12).
[7]Shiozawa S., Konishi Y., Murayama K., Mukae N., Yamamoto E., Hayashi S., Sato M., Shiozawa K., Tsukamoto Y.
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLY-159.
[8]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[9]NIEHS SNPs program
Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-23; GLY-159 AND ARG-254.
[10]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
Tissue: Brain.
[12]"TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)."
Bodmer J.-L., Burns K., Schneider P., Hofmann K., Steiner V., Thome M., Bornand T., Hahne M., Schroeter M., Wilson A., French L.E., Browning J.L., Macdonald H.R., Tschopp J.
Immunity 6:79-88(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-417.
Tissue: Brain and Fetal lung.
[13]Chaudhary P.M., Hood L.E.
Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 7-417.
Tissue: Brain.
[14]"Prevention of constitutive TNF receptor 1 signaling by silencer of death domains."
Jiang Y., Woronicz J.D., Liu W., Goeddel D.V.
Science 283:543-546(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH BAG4.
[15]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Y09392 mRNA. Translation: CAA70561.1.
Y09392 mRNA. Translation: CAA70559.1.
Y09392 mRNA. Translation: CAA70560.1.
U72763 mRNA. Translation: AAC50819.1.
U83599 Genomic DNA. Translation: AAB41434.1.
U83600 Genomic DNA. Translation: AAB41435.1.
U78029 mRNA. Translation: AAB40918.1.
U74611 mRNA. Translation: AAB39714.1.
U94501 mRNA. Translation: AAC51306.1.
U94504 mRNA. Translation: AAC51309.1.
U94502 mRNA. Translation: AAC51307.1.
U94503 mRNA. Translation: AAC51308.1.
U94505 mRNA. Translation: AAC51310.1.
U94506 mRNA. Translation: AAC51311.1.
U94507 mRNA. Translation: AAC51312.1.
U94508 mRNA. Translation: AAC51313.1.
U94509 mRNA. Translation: AAC51314.1.
U94510 mRNA. Translation: AAC51315.1.
U94512 mRNA. Translation: AAC51316.1.
U83598 mRNA. Translation: AAB41433.1.
AF026070 mRNA. Translation: AAC39556.1.
AF026071 mRNA. Translation: AAB82288.1.
AB051850 Genomic DNA. Translation: BAB40662.1.
AB051851 Genomic DNA. Translation: BAB40663.1.
AY358309 mRNA. Translation: AAQ88676.1.
AY254324 Genomic DNA. Translation: AAO63495.1.
U75380 mRNA. Translation: AAC51192.1.
AL158217 Genomic DNA. Translation: CAI22153.1.
AL158217 Genomic DNA. Translation: CAI22154.1.
AL158217 Genomic DNA. Translation: CAI22155.1.
BC117189 mRNA. Translation: AAI17190.1.
BC143886 mRNA. Translation: AAI43887.1.
U75381 mRNA. Translation: AAC51193.1.
U83597 mRNA. Translation: AAB41432.1.
CCDSCCDS71.1. [Q93038-1]
CCDS72.1. [Q93038-11]
CCDS73.1. [Q93038-10]
CCDS74.1. [Q93038-9]
CCDS75.1. [Q93038-8]
RefSeqNP_001034753.1. NM_001039664.1. [Q93038-5]
NP_003781.1. NM_003790.2. [Q93038-1]
NP_683866.1. NM_148965.1. [Q93038-11]
NP_683867.1. NM_148966.1. [Q93038-10]
NP_683868.1. NM_148967.1. [Q93038-9]
NP_683871.1. NM_148970.1. [Q93038-8]
UniGeneHs.462529.

3D structure databases

ProteinModelPortalQ93038.
SMRQ93038. Positions 40-179, 335-413.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114258. 10 interactions.
DIPDIP-59563N.

Chemistry

GuidetoPHARMACOLOGY1883.

Polymorphism databases

DMDM2501233.

Proteomic databases

PaxDbQ93038.
PRIDEQ93038.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000348333; ENSP00000314451; ENSG00000215788. [Q93038-9]
ENST00000351748; ENSP00000326762; ENSG00000215788. [Q93038-8]
ENST00000351959; ENSP00000337713; ENSG00000215788. [Q93038-10]
ENST00000356876; ENSP00000349341; ENSG00000215788. [Q93038-1]
ENST00000377782; ENSP00000367013; ENSG00000215788. [Q93038-11]
ENST00000414040; ENSP00000404274; ENSG00000215788. [Q93038-3]
ENST00000480393; ENSP00000434129; ENSG00000215788.
ENST00000485036; ENSP00000431554; ENSG00000215788. [Q93038-12]
ENST00000502588; ENSP00000423121; ENSG00000215788. [Q93038-6]
ENST00000502730; ENSP00000421976; ENSG00000215788. [Q93038-7]
ENST00000510563; ENSP00000424071; ENSG00000215788. [Q93038-5]
GeneID8718.
KEGGhsa:8718.
UCSCuc001ana.3. human. [Q93038-8]
uc001ane.3. human. [Q93038-1]
uc001anf.3. human. [Q93038-10]
uc001ang.3. human. [Q93038-9]
uc001anh.3. human. [Q93038-11]
uc001ani.1. human. [Q93038-5]

Organism-specific databases

CTD8718.
GeneCardsGC01M006521.
HGNCHGNC:11910. TNFRSF25.
MIM603366. gene.
neXtProtNX_Q93038.
PharmGKBPA36603.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG25022.
HOVERGENHBG058493.
KOK05160.
OMAPGPQLYD.
OrthoDBEOG744T9K.
PhylomeDBQ93038.
TreeFamTF333916.

Gene expression databases

ArrayExpressQ93038.
BgeeQ93038.
GenevestigatorQ93038.

Family and domain databases

Gene3D1.10.533.10. 1 hit.
InterProIPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR022329. TNFR_25.
[Graphical view]
PfamPF00531. Death. 1 hit.
[Graphical view]
PRINTSPR01972. TNFACTORR25.
SMARTSM00005. DEATH. 1 hit.
SM00208. TNFR. 2 hits.
[Graphical view]
SUPFAMSSF47986. SSF47986. 1 hit.
PROSITEPS50017. DEATH_DOMAIN. 1 hit.
PS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTNFRSF25.
GenomeRNAi8718.
NextBio32691.
PROQ93038.
SOURCESearch...

Entry information

Entry nameTNR25_HUMAN
AccessionPrimary (citable) accession number: Q93038
Secondary accession number(s): B1ALX2 expand/collapse secondary AC list , B1ALX3, B7ZLL7, O00275, O00276, O00277, O00278, O00279, O00280, O14865, O14866, P78507, P78515, Q17RU4, Q92983, Q93036, Q93037, Q99722, Q99830, Q99831, Q9BY86, Q9UME0, Q9UME1, Q9UME5
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: July 9, 2014
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM