Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q93038

- TNR25_HUMAN

UniProt

Q93038 - TNR25_HUMAN

Protein

Tumor necrosis factor receptor superfamily member 25

Gene

TNFRSF25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 143 (01 Oct 2014)
      Sequence version 2 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

    GO - Molecular functioni

    1. receptor activity Source: UniProtKB
    2. tumor necrosis factor-activated receptor activity Source: ProtInc

    GO - Biological processi

    1. apoptotic process Source: UniProtKB
    2. apoptotic signaling pathway Source: ProtInc
    3. cell surface receptor signaling pathway Source: ProtInc
    4. regulation of apoptotic process Source: UniProtKB
    5. signal transduction Source: ProtInc
    6. tumor necrosis factor-mediated signaling pathway Source: GOC

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Apoptosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tumor necrosis factor receptor superfamily member 25
    Alternative name(s):
    Apo-3
    Apoptosis-inducing receptor AIR
    Apoptosis-mediating receptor DR3
    Apoptosis-mediating receptor TRAMP
    Death receptor 3
    Lymphocyte-associated receptor of death
    Short name:
    LARD
    Protein WSL
    Protein WSL-1
    Gene namesi
    Name:TNFRSF25
    Synonyms:APO3, DDR3, DR3, TNFRSF12, WSL, WSL1
    ORF Names:UNQ455/PRO779
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:11910. TNFRSF25.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. extracellular region Source: UniProtKB-SubCell
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi354 – 3541L → A: Suppresses homodimerization, TNFR1 interaction, and apoptosis induction. 1 Publication
    Mutagenesisi356 – 3561L → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication
    Mutagenesisi373 – 3731D → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication

    Organism-specific databases

    PharmGKBiPA36603.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 417393Tumor necrosis factor receptor superfamily member 25PRO_0000034606Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
    Disulfide bondi48 ↔ 61PROSITE-ProRule annotation
    Disulfide bondi51 ↔ 70PROSITE-ProRule annotation
    Glycosylationi67 – 671N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi73 ↔ 89PROSITE-ProRule annotation
    Disulfide bondi92 ↔ 107PROSITE-ProRule annotation
    Disulfide bondi95 ↔ 115PROSITE-ProRule annotation
    Glycosylationi106 – 1061N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi117 ↔ 130PROSITE-ProRule annotation
    Disulfide bondi138 ↔ 155PROSITE-ProRule annotation
    Disulfide bondi141 ↔ 162PROSITE-ProRule annotation
    Disulfide bondi165 ↔ 176PROSITE-ProRule annotation
    Disulfide bondi179 ↔ 191PROSITE-ProRule annotation
    Disulfide bondi187 ↔ 195PROSITE-ProRule annotation

    Post-translational modificationi

    Glycosylated.Curated

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ93038.
    PRIDEiQ93038.

    Expressioni

    Tissue specificityi

    Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.

    Gene expression databases

    ArrayExpressiQ93038.
    BgeeiQ93038.
    GenevestigatoriQ93038.

    Interactioni

    Subunit structurei

    Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4.1 Publication

    Protein-protein interaction databases

    BioGridi114258. 10 interactions.
    DIPiDIP-59563N.

    Structurei

    3D structure databases

    ProteinModelPortaliQ93038.
    SMRiQ93038. Positions 40-179, 335-413.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini25 – 199175ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini221 – 417197CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei200 – 22021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati34 – 7138TNFR-Cys 1Add
    BLAST
    Repeati72 – 11544TNFR-Cys 2Add
    BLAST
    Repeati116 – 16348TNFR-Cys 3Add
    BLAST
    Repeati164 – 19229TNFR-Cys 4Add
    BLAST
    Domaini332 – 41382DeathPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 death domain.PROSITE-ProRule annotation
    Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG25022.
    HOVERGENiHBG058493.
    KOiK05160.
    OMAiPGPQLYD.
    OrthoDBiEOG744T9K.
    PhylomeDBiQ93038.
    TreeFamiTF333916.

    Family and domain databases

    Gene3Di1.10.533.10. 1 hit.
    InterProiIPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR022329. TNFR_25.
    [Graphical view]
    PfamiPF00531. Death. 1 hit.
    [Graphical view]
    PRINTSiPR01972. TNFACTORR25.
    SMARTiSM00005. DEATH. 1 hit.
    SM00208. TNFR. 2 hits.
    [Graphical view]
    SUPFAMiSSF47986. SSF47986. 1 hit.
    PROSITEiPS50017. DEATH_DOMAIN. 1 hit.
    PS00652. TNFR_NGFR_1. 2 hits.
    PS50050. TNFR_NGFR_2. 1 hit.
    [Graphical view]

    Sequences (12)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 12 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q93038-1) [UniParc]FASTAAdd to Basket

    Also known as: WSL-1, LARD-1A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEQRPRGCAA VAAALLLVLL GARAQGGTRS PRCDCAGDFH KKIGLFCCRG    50
    CPAGHYLKAP CTEPCGNSTC LVCPQDTFLA WENHHNSECA RCQACDEQAS 100
    QVALENCSAV ADTRCGCKPG WFVECQVSQC VSSSPFYCQP CLDCGALHRH 150
    TRLLCSRRDT DCGTCLPGFY EHGDGCVSCP TSTLGSCPER CAAVCGWRQM 200
    FWVQVLLAGL VVPLLLGATL TYTYRHCWPH KPLVTADEAG MEALTPPPAT 250
    HLSPLDSAHT LLAPPDSSEK ICTVQLVGNS WTPGYPETQE ALCPQVTWSW 300
    DQLPSRALGP AAAPTLSPES PAGSPAMMLQ PGPQLYDVMD AVPARRWKEF 350
    VRTLGLREAE IEAVEVEIGR FRDQQYEMLK RWRQQQPAGL GAVYAALERM 400
    GLDGCVEDLR SRLQRGP 417
    Length:417
    Mass (Da):45,385
    Last modified:November 1, 1997 - v2
    Checksum:i5226319DFDB46706
    GO
    Isoform 2 (identifier: Q93038-2) [UniParc]FASTAAdd to Basket

    Also known as: LARD-1B

    The sequence of this isoform differs from the canonical sequence as follows:
         236-236: A → AA

    Show »
    Length:418
    Mass (Da):45,456
    Checksum:i54B48F8B35C620E2
    GO
    Isoform 3 (identifier: Q93038-3) [UniParc]FASTAAdd to Basket

    Also known as: WSL-S1, LARD-3

    The sequence of this isoform differs from the canonical sequence as follows:
         182-218: STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA → VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR
         219-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:218
    Mass (Da):23,198
    Checksum:i9B416919AFA442F6
    GO
    Isoform 4 (identifier: Q93038-4) [UniParc]FASTAAdd to Basket

    Also known as: WSL-S2, LARD-2

    The sequence of this isoform differs from the canonical sequence as follows:
         200-253: MFWVQVLLAG...LTPPPATHLS → SRWCAGNARG...LWSPSCLGPP
         254-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:253
    Mass (Da):27,004
    Checksum:i50A06775B68FC3D7
    GO
    Isoform 5 (identifier: Q93038-5) [UniParc]FASTAAdd to Basket

    Also known as: LARD-4, LARD-11

    The sequence of this isoform differs from the canonical sequence as follows:
         182-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:181
    Mass (Da):19,432
    Checksum:i59AAFEDBBB46E369
    GO
    Isoform 6 (identifier: Q93038-6) [UniParc]FASTAAdd to Basket

    Also known as: LARD-5

    The sequence of this isoform differs from the canonical sequence as follows:
         54-98: Missing.
         182-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:136
    Mass (Da):14,439
    Checksum:i6846913006EEE40A
    GO
    Isoform 7 (identifier: Q93038-7) [UniParc]FASTAAdd to Basket

    Also known as: LARD-6

    The sequence of this isoform differs from the canonical sequence as follows:
         54-98: Missing.
         156-171: SRRDTDCGTCLPGFYE → HPSVTLGQRPHPSSTS
         172-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:126
    Mass (Da):13,349
    Checksum:iEBAC98D7FB3EDB68
    GO
    Isoform 8 (identifier: Q93038-8) [UniParc]FASTAAdd to Basket

    Also known as: LARD-7

    The sequence of this isoform differs from the canonical sequence as follows:
         54-236: Missing.

    Show »
    Length:234
    Mass (Da):25,373
    Checksum:iD082A4552EDF7531
    GO
    Isoform 9 (identifier: Q93038-9) [UniParc]FASTAAdd to Basket

    Also known as: LARD-8

    The sequence of this isoform differs from the canonical sequence as follows:
         54-98: Missing.

    Show »
    Length:372
    Mass (Da):40,391
    Checksum:iD4F87353AB7F40F6
    GO
    Isoform 10 (identifier: Q93038-10) [UniParc]FASTAAdd to Basket

    Also known as: LARD-9

    The sequence of this isoform differs from the canonical sequence as follows:
         200-237: MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD → N

    Show »
    Length:380
    Mass (Da):41,193
    Checksum:iED19B586ADD947B7
    GO
    Isoform 11 (identifier: Q93038-11) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         182-200: STLGSCPERCAAVCGWRQM → PPPSLAGAPWGAVQSAVPLSVAGGRVGV

    Show »
    Length:426
    Mass (Da):45,928
    Checksum:i292A9B2899F3AE1F
    GO
    Isoform 12 (identifier: Q93038-12) [UniParc]FASTAAdd to Basket

    Also known as: Beta soluble

    The sequence of this isoform differs from the canonical sequence as follows:
         182-277: STLGSCPERC...SEKICTVQLV → PPPSLAGAPW...LASQAPGYCR
         278-417: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:277
    Mass (Da):29,111
    Checksum:i3D19F3E847BFC093
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti4 – 63RPR → AAA in AAC51192. (PubMed:9052839)Curated
    Sequence conflicti4 – 63RPR → AAA in AAC51193. (PubMed:9052839)Curated
    Sequence conflicti60 – 601P → H in AAB41435. 1 PublicationCurated
    Sequence conflicti167 – 1671P → L(PubMed:9052839)Curated
    Sequence conflicti167 – 1671P → L1 PublicationCurated
    Sequence conflicti312 – 3121A → R(PubMed:8934525)Curated
    Sequence conflicti312 – 3121A → R(PubMed:9446802)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti23 – 231R → Q.1 Publication
    Corresponds to variant rs35771371 [ dbSNP | Ensembl ].
    VAR_018826
    Natural varianti159 – 1591D → G.2 Publications
    Corresponds to variant rs11800462 [ dbSNP | Ensembl ].
    VAR_018827
    Natural varianti254 – 2541P → R.1 Publication
    Corresponds to variant rs34529016 [ dbSNP | Ensembl ].
    VAR_018828
    Natural varianti370 – 3701R → L.
    Corresponds to variant rs1064590 [ dbSNP | Ensembl ].
    VAR_011814
    Natural varianti381 – 3811R → H.
    Corresponds to variant rs1059333 [ dbSNP | Ensembl ].
    VAR_011815

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei54 – 236183Missing in isoform 8. 1 PublicationVSP_006492Add
    BLAST
    Alternative sequencei54 – 9845Missing in isoform 6, isoform 7 and isoform 9. 1 PublicationVSP_006491Add
    BLAST
    Alternative sequencei156 – 17116SRRDT…PGFYE → HPSVTLGQRPHPSSTS in isoform 7. 1 PublicationVSP_006493Add
    BLAST
    Alternative sequencei172 – 417246Missing in isoform 7. 1 PublicationVSP_006494Add
    BLAST
    Alternative sequencei182 – 417236Missing in isoform 5 and isoform 6. 1 PublicationVSP_006495Add
    BLAST
    Alternative sequencei182 – 27796STLGS…TVQLV → PPPSLAGAPWGAVQSAVPLS VAGGRVGGVLGMRVGELGWT EGRRVRRGATTQHPPAAFSV LGPGAPGWPCGPPPAWGHPD LHIPPLLASQAPGYCR in isoform 12. 1 PublicationVSP_006499Add
    BLAST
    Alternative sequencei182 – 21837STLGS…LLLGA → VLGPGAPGWPCGPPPAWGHP DLHIPPLLASQAPGYCR in isoform 3. 2 PublicationsVSP_006497Add
    BLAST
    Alternative sequencei182 – 20019STLGS…GWRQM → PPPSLAGAPWGAVQSAVPLS VAGGRVGV in isoform 11. 1 PublicationVSP_006496Add
    BLAST
    Alternative sequencei200 – 25354MFWVQ…ATHLS → SRWCAGNARGRTGMDRGEAG EEGGNHPTPTSCFQCSGSRC SWLALWSPSCLGPP in isoform 4. 2 PublicationsVSP_006501Add
    BLAST
    Alternative sequencei200 – 23738MFWVQ…LVTAD → N in isoform 10. 2 PublicationsVSP_006503Add
    BLAST
    Alternative sequencei219 – 417199Missing in isoform 3. 2 PublicationsVSP_006498Add
    BLAST
    Alternative sequencei236 – 2361A → AA in isoform 2. 1 PublicationVSP_006504
    Alternative sequencei254 – 417164Missing in isoform 4. 2 PublicationsVSP_006502Add
    BLAST
    Alternative sequencei278 – 417140Missing in isoform 12. 1 PublicationVSP_006500Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y09392 mRNA. Translation: CAA70561.1.
    Y09392 mRNA. Translation: CAA70559.1.
    Y09392 mRNA. Translation: CAA70560.1.
    U72763 mRNA. Translation: AAC50819.1.
    U83599 Genomic DNA. Translation: AAB41434.1.
    U83600 Genomic DNA. Translation: AAB41435.1.
    U78029 mRNA. Translation: AAB40918.1.
    U74611 mRNA. Translation: AAB39714.1.
    U94501 mRNA. Translation: AAC51306.1.
    U94504 mRNA. Translation: AAC51309.1.
    U94502 mRNA. Translation: AAC51307.1.
    U94503 mRNA. Translation: AAC51308.1.
    U94505 mRNA. Translation: AAC51310.1.
    U94506 mRNA. Translation: AAC51311.1.
    U94507 mRNA. Translation: AAC51312.1.
    U94508 mRNA. Translation: AAC51313.1.
    U94509 mRNA. Translation: AAC51314.1.
    U94510 mRNA. Translation: AAC51315.1.
    U94512 mRNA. Translation: AAC51316.1.
    U83598 mRNA. Translation: AAB41433.1.
    AF026070 mRNA. Translation: AAC39556.1.
    AF026071 mRNA. Translation: AAB82288.1.
    AB051850 Genomic DNA. Translation: BAB40662.1.
    AB051851 Genomic DNA. Translation: BAB40663.1.
    AY358309 mRNA. Translation: AAQ88676.1.
    AY254324 Genomic DNA. Translation: AAO63495.1.
    U75380 mRNA. Translation: AAC51192.1.
    AL158217 Genomic DNA. Translation: CAI22153.1.
    AL158217 Genomic DNA. Translation: CAI22154.1.
    AL158217 Genomic DNA. Translation: CAI22155.1.
    BC117189 mRNA. Translation: AAI17190.1.
    BC143886 mRNA. Translation: AAI43887.1.
    U75381 mRNA. Translation: AAC51193.1.
    U83597 mRNA. Translation: AAB41432.1.
    CCDSiCCDS71.1. [Q93038-1]
    CCDS72.1. [Q93038-11]
    CCDS73.1. [Q93038-10]
    CCDS74.1. [Q93038-9]
    CCDS75.1. [Q93038-8]
    RefSeqiNP_001034753.1. NM_001039664.1. [Q93038-5]
    NP_003781.1. NM_003790.2. [Q93038-1]
    NP_683866.1. NM_148965.1. [Q93038-11]
    NP_683867.1. NM_148966.1. [Q93038-10]
    NP_683868.1. NM_148967.1. [Q93038-9]
    NP_683871.1. NM_148970.1. [Q93038-8]
    UniGeneiHs.462529.

    Genome annotation databases

    EnsembliENST00000348333; ENSP00000314451; ENSG00000215788. [Q93038-9]
    ENST00000351748; ENSP00000326762; ENSG00000215788. [Q93038-8]
    ENST00000351959; ENSP00000337713; ENSG00000215788. [Q93038-10]
    ENST00000356876; ENSP00000349341; ENSG00000215788. [Q93038-1]
    ENST00000377782; ENSP00000367013; ENSG00000215788. [Q93038-11]
    ENST00000414040; ENSP00000404274; ENSG00000215788. [Q93038-3]
    ENST00000480393; ENSP00000434129; ENSG00000215788.
    ENST00000485036; ENSP00000431554; ENSG00000215788. [Q93038-12]
    ENST00000502588; ENSP00000423121; ENSG00000215788. [Q93038-6]
    ENST00000502730; ENSP00000421976; ENSG00000215788. [Q93038-7]
    ENST00000510563; ENSP00000424071; ENSG00000215788. [Q93038-5]
    GeneIDi8718.
    KEGGihsa:8718.
    UCSCiuc001ana.3. human. [Q93038-8]
    uc001ane.3. human. [Q93038-1]
    uc001anf.3. human. [Q93038-10]
    uc001ang.3. human. [Q93038-9]
    uc001anh.3. human. [Q93038-11]
    uc001ani.1. human. [Q93038-5]

    Polymorphism databases

    DMDMi2501233.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y09392 mRNA. Translation: CAA70561.1 .
    Y09392 mRNA. Translation: CAA70559.1 .
    Y09392 mRNA. Translation: CAA70560.1 .
    U72763 mRNA. Translation: AAC50819.1 .
    U83599 Genomic DNA. Translation: AAB41434.1 .
    U83600 Genomic DNA. Translation: AAB41435.1 .
    U78029 mRNA. Translation: AAB40918.1 .
    U74611 mRNA. Translation: AAB39714.1 .
    U94501 mRNA. Translation: AAC51306.1 .
    U94504 mRNA. Translation: AAC51309.1 .
    U94502 mRNA. Translation: AAC51307.1 .
    U94503 mRNA. Translation: AAC51308.1 .
    U94505 mRNA. Translation: AAC51310.1 .
    U94506 mRNA. Translation: AAC51311.1 .
    U94507 mRNA. Translation: AAC51312.1 .
    U94508 mRNA. Translation: AAC51313.1 .
    U94509 mRNA. Translation: AAC51314.1 .
    U94510 mRNA. Translation: AAC51315.1 .
    U94512 mRNA. Translation: AAC51316.1 .
    U83598 mRNA. Translation: AAB41433.1 .
    AF026070 mRNA. Translation: AAC39556.1 .
    AF026071 mRNA. Translation: AAB82288.1 .
    AB051850 Genomic DNA. Translation: BAB40662.1 .
    AB051851 Genomic DNA. Translation: BAB40663.1 .
    AY358309 mRNA. Translation: AAQ88676.1 .
    AY254324 Genomic DNA. Translation: AAO63495.1 .
    U75380 mRNA. Translation: AAC51192.1 .
    AL158217 Genomic DNA. Translation: CAI22153.1 .
    AL158217 Genomic DNA. Translation: CAI22154.1 .
    AL158217 Genomic DNA. Translation: CAI22155.1 .
    BC117189 mRNA. Translation: AAI17190.1 .
    BC143886 mRNA. Translation: AAI43887.1 .
    U75381 mRNA. Translation: AAC51193.1 .
    U83597 mRNA. Translation: AAB41432.1 .
    CCDSi CCDS71.1. [Q93038-1 ]
    CCDS72.1. [Q93038-11 ]
    CCDS73.1. [Q93038-10 ]
    CCDS74.1. [Q93038-9 ]
    CCDS75.1. [Q93038-8 ]
    RefSeqi NP_001034753.1. NM_001039664.1. [Q93038-5 ]
    NP_003781.1. NM_003790.2. [Q93038-1 ]
    NP_683866.1. NM_148965.1. [Q93038-11 ]
    NP_683867.1. NM_148966.1. [Q93038-10 ]
    NP_683868.1. NM_148967.1. [Q93038-9 ]
    NP_683871.1. NM_148970.1. [Q93038-8 ]
    UniGenei Hs.462529.

    3D structure databases

    ProteinModelPortali Q93038.
    SMRi Q93038. Positions 40-179, 335-413.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114258. 10 interactions.
    DIPi DIP-59563N.

    Chemistry

    GuidetoPHARMACOLOGYi 1883.

    Polymorphism databases

    DMDMi 2501233.

    Proteomic databases

    PaxDbi Q93038.
    PRIDEi Q93038.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000348333 ; ENSP00000314451 ; ENSG00000215788 . [Q93038-9 ]
    ENST00000351748 ; ENSP00000326762 ; ENSG00000215788 . [Q93038-8 ]
    ENST00000351959 ; ENSP00000337713 ; ENSG00000215788 . [Q93038-10 ]
    ENST00000356876 ; ENSP00000349341 ; ENSG00000215788 . [Q93038-1 ]
    ENST00000377782 ; ENSP00000367013 ; ENSG00000215788 . [Q93038-11 ]
    ENST00000414040 ; ENSP00000404274 ; ENSG00000215788 . [Q93038-3 ]
    ENST00000480393 ; ENSP00000434129 ; ENSG00000215788 .
    ENST00000485036 ; ENSP00000431554 ; ENSG00000215788 . [Q93038-12 ]
    ENST00000502588 ; ENSP00000423121 ; ENSG00000215788 . [Q93038-6 ]
    ENST00000502730 ; ENSP00000421976 ; ENSG00000215788 . [Q93038-7 ]
    ENST00000510563 ; ENSP00000424071 ; ENSG00000215788 . [Q93038-5 ]
    GeneIDi 8718.
    KEGGi hsa:8718.
    UCSCi uc001ana.3. human. [Q93038-8 ]
    uc001ane.3. human. [Q93038-1 ]
    uc001anf.3. human. [Q93038-10 ]
    uc001ang.3. human. [Q93038-9 ]
    uc001anh.3. human. [Q93038-11 ]
    uc001ani.1. human. [Q93038-5 ]

    Organism-specific databases

    CTDi 8718.
    GeneCardsi GC01M006521.
    HGNCi HGNC:11910. TNFRSF25.
    MIMi 603366. gene.
    neXtProti NX_Q93038.
    PharmGKBi PA36603.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG25022.
    HOVERGENi HBG058493.
    KOi K05160.
    OMAi PGPQLYD.
    OrthoDBi EOG744T9K.
    PhylomeDBi Q93038.
    TreeFami TF333916.

    Miscellaneous databases

    GeneWikii TNFRSF25.
    GenomeRNAii 8718.
    NextBioi 32691.
    PROi Q93038.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q93038.
    Bgeei Q93038.
    Genevestigatori Q93038.

    Family and domain databases

    Gene3Di 1.10.533.10. 1 hit.
    InterProi IPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR022329. TNFR_25.
    [Graphical view ]
    Pfami PF00531. Death. 1 hit.
    [Graphical view ]
    PRINTSi PR01972. TNFACTORR25.
    SMARTi SM00005. DEATH. 1 hit.
    SM00208. TNFR. 2 hits.
    [Graphical view ]
    SUPFAMi SSF47986. SSF47986. 1 hit.
    PROSITEi PS50017. DEATH_DOMAIN. 1 hit.
    PS00652. TNFR_NGFR_1. 2 hits.
    PS50050. TNFR_NGFR_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), MUTAGENESIS.
      Tissue: Lymphoid tissue.
    2. "Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95."
      Chinnaiyan A.M., O'Rourke K., Yu G.-L., Lyons R.H., Garg M., Duan D.R., Xing L., Gentz R., Ni J., Dixit V.M.
      Science 274:990-992(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Umbilical vein endothelial cell.
    3. Degli-Esposti M.A., Din W.S., Cosman D., Smith C.A., Goodwin R.G.
      Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    4. "Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa-B."
      Marsters S.A., Sheridan J.P., Donahue C.J., Pitti R.M., Gray C.L., Goddard A.D., Bauer K.D., Ashkenazi A.
      Curr. Biol. 6:1669-1676(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Heart.
    5. "LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing."
      Screaton G.R., Xu X.-N., Olsen A.L., Cowper A.E., Tan R., McMichael A.J., Bell J.I.
      Proc. Natl. Acad. Sci. U.S.A. 94:4615-4619(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
    6. "A new death receptor 3 isoform: expression in human lymphoid cell lines and non-Hodgkin's lymphomas."
      Warzocha K., Ribeiro P., Charlot C., Renard N., Coiffier B., Salles G.
      Biochem. Biophys. Res. Commun. 242:376-379(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 11 AND 12).
    7. Shiozawa S., Konishi Y., Murayama K., Mukae N., Yamamoto E., Hayashi S., Sato M., Shiozawa K., Tsukamoto Y.
      Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLY-159.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    9. NIEHS SNPs program
      Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-23; GLY-159 AND ARG-254.
    10. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
      Tissue: Brain.
    12. "TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)."
      Bodmer J.-L., Burns K., Schneider P., Hofmann K., Steiner V., Thome M., Bornand T., Hahne M., Schroeter M., Wilson A., French L.E., Browning J.L., Macdonald H.R., Tschopp J.
      Immunity 6:79-88(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-417.
      Tissue: Brain and Fetal lung.
    13. Chaudhary P.M., Hood L.E.
      Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 7-417.
      Tissue: Brain.
    14. "Prevention of constitutive TNF receptor 1 signaling by silencer of death domains."
      Jiang Y., Woronicz J.D., Liu W., Goeddel D.V.
      Science 283:543-546(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH BAG4.
    15. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

    Entry informationi

    Entry nameiTNR25_HUMAN
    AccessioniPrimary (citable) accession number: Q93038
    Secondary accession number(s): B1ALX2
    , B1ALX3, B7ZLL7, O00275, O00276, O00277, O00278, O00279, O00280, O14865, O14866, P78507, P78515, Q17RU4, Q92983, Q93036, Q93037, Q99722, Q99830, Q99831, Q9BY86, Q9UME0, Q9UME1, Q9UME5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 143 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3