Q93038 (TNR25_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor necrosis factor receptor superfamily member 25 Alternative name(s): Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Short name=LARD Protein WSL Protein WSL-1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 417 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. |
| Subunit structure | Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4. Ref.14 |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Cell membrane; Single-pass type I membrane protein. Isoform 9: Cell membrane; Single-pass type I membrane protein. Isoform 11: Cell membrane; Single-pass type I membrane protein. |
| Tissue specificity | Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate. |
| Post-translational modification | Glycosylated Probable. |
| Sequence similarities | Contains 1 death domain. Contains 4 TNFR-Cys repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic signaling pathway Traceable author statement Ref.4. Source: ProtInc induction of apoptosisTraceable author statement Ref.2. Source: ProtInc |
| Cellular_component | cytosol Non-traceable author statement Ref.5. Source: UniProtKB extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement Ref.12. Source: ProtInc |
| Molecular_function | tumor necrosis factor-activated receptor activity Traceable author statement Ref.12. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 12 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q93038-1) Also known as: WSL-1; LARD-1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q93038-2) Also known as: LARD-1B; The sequence of this isoform differs from the canonical sequence as follows: 236-236: A → AA | ||||||
| Isoform 3 (identifier: Q93038-3) Also known as: WSL-S1; LARD-3; The sequence of this isoform differs from the canonical sequence as follows: 182-218: STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA → VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR 219-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q93038-4) Also known as: WSL-S2; LARD-2; The sequence of this isoform differs from the canonical sequence as follows: 200-253: MFWVQVLLAG...LTPPPATHLS → SRWCAGNARG...LWSPSCLGPP 254-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 5 (identifier: Q93038-5) Also known as: LARD-4; LARD-11; The sequence of this isoform differs from the canonical sequence as follows: 182-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 6 (identifier: Q93038-6) Also known as: LARD-5; The sequence of this isoform differs from the canonical sequence as follows: 54-98: Missing. 182-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 7 (identifier: Q93038-7) Also known as: LARD-6; The sequence of this isoform differs from the canonical sequence as follows: 54-98: Missing. 156-171: SRRDTDCGTCLPGFYE → HPSVTLGQRPHPSSTS 172-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 8 (identifier: Q93038-8) Also known as: LARD-7; The sequence of this isoform differs from the canonical sequence as follows: 54-236: Missing. | ||||||
| Isoform 9 (identifier: Q93038-9) Also known as: LARD-8; The sequence of this isoform differs from the canonical sequence as follows: 54-98: Missing. | ||||||
| Isoform 10 (identifier: Q93038-10) Also known as: LARD-9; The sequence of this isoform differs from the canonical sequence as follows: 200-237: MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD → N | ||||||
| Isoform 11 (identifier: Q93038-11) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 182-200: STLGSCPERCAAVCGWRQM → PPPSLAGAPWGAVQSAVPLSVAGGRVGV | ||||||
| Isoform 12 (identifier: Q93038-12) Also known as: Beta soluble; The sequence of this isoform differs from the canonical sequence as follows: 182-277: STLGSCPERC...SEKICTVQLV → PPPSLAGAPW...LASQAPGYCR 278-417: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||||
| Chain | 25 – 417 | 393 | Tumor necrosis factor receptor superfamily member 25 | PRO_0000034606 | |||||||
Regions | |||||||||||
| Topological domain | 25 – 199 | 175 | Extracellular Potential | ||||||||
| Transmembrane | 200 – 220 | 21 | Helical; Potential | ||||||||
| Topological domain | 221 – 417 | 197 | Cytoplasmic Potential | ||||||||
| Repeat | 34 – 71 | 38 | TNFR-Cys 1 | ||||||||
| Repeat | 72 – 115 | 44 | TNFR-Cys 2 | ||||||||
| Repeat | 116 – 163 | 48 | TNFR-Cys 3 | ||||||||
| Repeat | 164 – 192 | 29 | TNFR-Cys 4 | ||||||||
| Domain | 332 – 413 | 82 | Death | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 67 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 106 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 35 ↔ 47 | By similarity | |||||||||
| Disulfide bond | 48 ↔ 61 | By similarity | |||||||||
| Disulfide bond | 51 ↔ 70 | By similarity | |||||||||
| Disulfide bond | 73 ↔ 89 | By similarity | |||||||||
| Disulfide bond | 92 ↔ 107 | By similarity | |||||||||
| Disulfide bond | 95 ↔ 115 | By similarity | |||||||||
| Disulfide bond | 117 ↔ 130 | By similarity | |||||||||
| Disulfide bond | 138 ↔ 155 | By similarity | |||||||||
| Disulfide bond | 141 ↔ 162 | By similarity | |||||||||
| Disulfide bond | 165 ↔ 176 | By similarity | |||||||||
| Disulfide bond | 179 ↔ 191 | By similarity | |||||||||
| Disulfide bond | 187 ↔ 195 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 54 – 236 | 183 | Missing in isoform 8. | VSP_006492 | |||||||
| Alternative sequence | 54 – 98 | 45 | Missing in isoform 6, isoform 7 and isoform 9. | VSP_006491 | |||||||
| Alternative sequence | 156 – 171 | 16 | SRRDT…PGFYE → HPSVTLGQRPHPSSTS in isoform 7. | VSP_006493 | |||||||
| Alternative sequence | 172 – 417 | 246 | Missing in isoform 7. | VSP_006494 | |||||||
| Alternative sequence | 182 – 417 | 236 | Missing in isoform 5 and isoform 6. | VSP_006495 | |||||||
| Alternative sequence | 182 – 277 | 96 | STLGS…TVQLV → PPPSLAGAPWGAVQSAVPLS VAGGRVGGVLGMRVGELGWT EGRRVRRGATTQHPPAAFSV LGPGAPGWPCGPPPAWGHPD LHIPPLLASQAPGYCR in isoform 12. | VSP_006499 | |||||||
| Alternative sequence | 182 – 218 | 37 | STLGS…LLLGA → VLGPGAPGWPCGPPPAWGHP DLHIPPLLASQAPGYCR in isoform 3. | VSP_006497 | |||||||
| Alternative sequence | 182 – 200 | 19 | STLGS…GWRQM → PPPSLAGAPWGAVQSAVPLS VAGGRVGV in isoform 11. | VSP_006496 | |||||||
| Alternative sequence | 200 – 253 | 54 | MFWVQ…ATHLS → SRWCAGNARGRTGMDRGEAG EEGGNHPTPTSCFQCSGSRC SWLALWSPSCLGPP in isoform 4. | VSP_006501 | |||||||
| Alternative sequence | 200 – 237 | 38 | MFWVQ…LVTAD → N in isoform 10. | VSP_006503 | |||||||
| Alternative sequence | 219 – 417 | 199 | Missing in isoform 3. | VSP_006498 | |||||||
| Alternative sequence | 236 | 1 | A → AA in isoform 2. | VSP_006504 | |||||||
| Alternative sequence | 254 – 417 | 164 | Missing in isoform 4. | VSP_006502 | |||||||
| Alternative sequence | 278 – 417 | 140 | Missing in isoform 12. | VSP_006500 | |||||||
| Natural variant | 23 | 1 | R → Q. Ref.9 Corresponds to variant rs35771371 [ dbSNP | Ensembl ]. | VAR_018826 | |||||||
| Natural variant | 159 | 1 | D → G. Ref.7 Ref.9 Corresponds to variant rs11800462 [ dbSNP | Ensembl ]. | VAR_018827 | |||||||
| Natural variant | 254 | 1 | P → R. Ref.9 Corresponds to variant rs34529016 [ dbSNP | Ensembl ]. | VAR_018828 | |||||||
| Natural variant | 370 | 1 | R → L. Corresponds to variant rs1064590 [ dbSNP | Ensembl ]. | VAR_011814 | |||||||
| Natural variant | 381 | 1 | R → H. Corresponds to variant rs1059333 [ dbSNP | Ensembl ]. | VAR_011815 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 354 | 1 | L → A: Suppresses homodimerization, TNFR1 interaction, and apoptosis induction. | ||||||||
| Mutagenesis | 356 | 1 | L → A: Suppresses homodimerization, and TNFR1 interaction. | ||||||||
| Mutagenesis | 373 | 1 | D → A: Suppresses homodimerization, and TNFR1 interaction. | ||||||||
| Sequence conflict | 4 – 6 | 3 | RPR → AAA in AAC51192. Ref.12 | ||||||||
| Sequence conflict | 4 – 6 | 3 | RPR → AAA in AAC51193. Ref.12 | ||||||||
| Sequence conflict | 60 | 1 | P → H in AAB41435. Ref.13 | ||||||||
| Sequence conflict | 167 | 1 | P → L Ref.12 | ||||||||
| Sequence conflict | 167 | 1 | P → L Ref.13 | ||||||||
| Sequence conflict | 312 | 1 | A → R Ref.1 | ||||||||
| Sequence conflict | 312 | 1 | A → R Ref.6 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A death-domain-containing receptor that mediates apoptosis." Kitson J., Raven T., Jiang Y.-P., Goeddel D.V., Giles K.M., Pun K.-T., Grinham C.J., Brown R., Farrow S.N. Nature 384:372-375(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), MUTAGENESIS. Tissue: Lymphoid tissue. |
| [2] | "Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95." Chinnaiyan A.M., O'Rourke K., Yu G.-L., Lyons R.H., Garg M., Duan D.R., Xing L., Gentz R., Ni J., Dixit V.M. Science 274:990-992(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Umbilical vein endothelial cell. |
| [3] | Degli-Esposti M.A., Din W.S., Cosman D., Smith C.A., Goodwin R.G. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [4] | "Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa-B." Marsters S.A., Sheridan J.P., Donahue C.J., Pitti R.M., Gray C.L., Goddard A.D., Bauer K.D., Ashkenazi A. Curr. Biol. 6:1669-1676(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Heart. |
| [5] | "LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing." Screaton G.R., Xu X.-N., Olsen A.L., Cowper A.E., Tan R., McMichael A.J., Bell J.I. Proc. Natl. Acad. Sci. U.S.A. 94:4615-4619(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10). |
| [6] | "A new death receptor 3 isoform: expression in human lymphoid cell lines and non-Hodgkin's lymphomas." Warzocha K., Ribeiro P., Charlot C., Renard N., Coiffier B., Salles G. Biochem. Biophys. Res. Commun. 242:376-379(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 11 AND 12). |
| [7] | Shiozawa S., Konishi Y., Murayama K., Mukae N., Yamamoto E., Hayashi S., Sato M., Shiozawa K., Tsukamoto Y. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLY-159. |
| [8] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [9] | NIEHS SNPs program Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-23; GLY-159 AND ARG-254. |
| [10] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10). Tissue: Brain. |
| [12] | "TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)." Bodmer J.-L., Burns K., Schneider P., Hofmann K., Steiner V., Thome M., Bornand T., Hahne M., Schroeter M., Wilson A., French L.E., Browning J.L., Macdonald H.R., Tschopp J. Immunity 6:79-88(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-417. Tissue: Brain and Fetal lung. |
| [13] | Chaudhary P.M., Hood L.E. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 7-417. Tissue: Brain. |
| [14] | "Prevention of constitutive TNF receptor 1 signaling by silencer of death domains." Jiang Y., Woronicz J.D., Liu W., Goeddel D.V. Science 283:543-546(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BAG4. |
| [15] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y09392 mRNA. Translation: CAA70561.1. Y09392 mRNA. Translation: CAA70559.1. Y09392 mRNA. Translation: CAA70560.1. U72763 mRNA. Translation: AAC50819.1. U83599 Genomic DNA. Translation: AAB41434.1. U83600 Genomic DNA. Translation: AAB41435.1. U78029 mRNA. Translation: AAB40918.1. U74611 mRNA. Translation: AAB39714.1. U94501 mRNA. Translation: AAC51306.1. U94504 mRNA. Translation: AAC51309.1. U94502 mRNA. Translation: AAC51307.1. U94503 mRNA. Translation: AAC51308.1. U94505 mRNA. Translation: AAC51310.1. U94506 mRNA. Translation: AAC51311.1. U94507 mRNA. Translation: AAC51312.1. U94508 mRNA. Translation: AAC51313.1. U94509 mRNA. Translation: AAC51314.1. U94510 mRNA. Translation: AAC51315.1. U94512 mRNA. Translation: AAC51316.1. U83598 mRNA. Translation: AAB41433.1. AF026070 mRNA. Translation: AAC39556.1. AF026071 mRNA. Translation: AAB82288.1. AB051850 Genomic DNA. Translation: BAB40662.1. AB051851 Genomic DNA. Translation: BAB40663.1. AY358309 mRNA. Translation: AAQ88676.1. AY254324 Genomic DNA. Translation: AAO63495.1. U75380 mRNA. Translation: AAC51192.1. AL158217 Genomic DNA. Translation: CAI22153.1. AL158217 Genomic DNA. Translation: CAI22154.1. AL158217 Genomic DNA. Translation: CAI22155.1. BC117189 mRNA. Translation: AAI17190.1. BC143886 mRNA. Translation: AAI43887.1. U75381 mRNA. Translation: AAC51193.1. U83597 mRNA. Translation: AAB41432.1. |
| IPI | IPI00003999. IPI00219572. IPI00219573. IPI00219577. IPI00219578. IPI00219579. IPI00219580. IPI00220675. IPI00220676. IPI00220677. IPI00299520. IPI00514425. |
| RefSeq | NP_001034753.1. NM_001039664.1. NP_003781.1. NM_003790.2. NP_683866.1. NM_148965.1. NP_683867.1. NM_148966.1. NP_683868.1. NM_148967.1. NP_683871.1. NM_148970.1. |
| UniGene | Hs.462529. |
3D structure databases | |
| ProteinModelPortal | Q93038. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-59563N. |
Polymorphism databases | |
| DMDM | 2501233. |
Proteomic databases | |
| PaxDb | Q93038. |
| PRIDE | Q93038. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000348333; ENSP00000314451; ENSG00000215788. ENST00000351748; ENSP00000326762; ENSG00000215788. ENST00000351959; ENSP00000337713; ENSG00000215788. ENST00000356876; ENSP00000349341; ENSG00000215788. ENST00000377782; ENSP00000367013; ENSG00000215788. ENST00000414040; ENSP00000404274; ENSG00000215788. ENST00000480393; ENSP00000434129; ENSG00000215788. ENST00000485036; ENSP00000431554; ENSG00000215788. ENST00000502588; ENSP00000423121; ENSG00000215788. ENST00000502730; ENSP00000421976; ENSG00000215788. ENST00000510563; ENSP00000424071; ENSG00000215788. |
| GeneID | 8718. |
| KEGG | hsa:8718. |
| UCSC | uc001ana.3. human. uc001ane.3. human. uc001anf.3. human. uc001ang.3. human. uc001anh.3. human. uc001ani.1. human. |
Organism-specific databases | |
| CTD | 8718. |
| GeneCards | GC01M006521. |
| HGNC | HGNC:11910. TNFRSF25. |
| MIM | 603366. gene. |
| neXtProt | NX_Q93038. |
| PharmGKB | PA36603. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG25022. |
| HOVERGEN | HBG058493. |
| KO | K05160. |
| OMA | WDQLPSR. |
| OrthoDB | EOG4HMJ9R. |
Gene expression databases | |
| ArrayExpress | Q93038. |
| Bgee | Q93038. |
| Genevestigator | Q93038. |
| GermOnline | ENSG00000171680. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.533.10. 1 hit. |
| InterPro | IPR011029. DEATH-like_dom. IPR000488. Death_domain. IPR001368. TNFR/NGFR_Cys_rich_reg. IPR022329. TNFR_25. [Graphical view] |
| Pfam | PF00531. Death. 1 hit. [Graphical view] |
| PRINTS | PR01972. TNFACTORR25. |
| SMART | SM00005. DEATH. 1 hit. SM00208. TNFR. 2 hits. [Graphical view] |
| SUPFAM | SSF47986. DEATH_like. 1 hit. |
| PROSITE | PS50017. DEATH_DOMAIN. 1 hit. PS00652. TNFR_NGFR_1. 2 hits. PS50050. TNFR_NGFR_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8718. |
| NextBio | 32691. |
| SOURCE | Search... |
Entry information
| Entry name | TNR25_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q93038 Secondary accession number(s): B1ALX2 Q9UME5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
