Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q93038

- TNR25_HUMAN

UniProt

Q93038 - TNR25_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tumor necrosis factor receptor superfamily member 25

Gene

TNFRSF25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

GO - Molecular functioni

  1. receptor activity Source: UniProtKB
  2. tumor necrosis factor-activated receptor activity Source: ProtInc

GO - Biological processi

  1. apoptotic process Source: UniProtKB
  2. apoptotic signaling pathway Source: ProtInc
  3. cell surface receptor signaling pathway Source: ProtInc
  4. regulation of apoptotic process Source: UniProtKB
  5. signal transduction Source: ProtInc
  6. tumor necrosis factor-mediated signaling pathway Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 25
Alternative name(s):
Apo-3
Apoptosis-inducing receptor AIR
Apoptosis-mediating receptor DR3
Apoptosis-mediating receptor TRAMP
Death receptor 3
Lymphocyte-associated receptor of death
Short name:
LARD
Protein WSL
Protein WSL-1
Gene namesi
Name:TNFRSF25
Synonyms:APO3, DDR3, DR3, TNFRSF12, WSL, WSL1
ORF Names:UNQ455/PRO779
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:11910. TNFRSF25.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. extracellular region Source: UniProtKB-KW
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi354 – 3541L → A: Suppresses homodimerization, TNFR1 interaction, and apoptosis induction. 1 Publication
Mutagenesisi356 – 3561L → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication
Mutagenesisi373 – 3731D → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication

Organism-specific databases

PharmGKBiPA36603.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Chaini25 – 417393Tumor necrosis factor receptor superfamily member 25PRO_0000034606Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
Disulfide bondi48 ↔ 61PROSITE-ProRule annotation
Disulfide bondi51 ↔ 70PROSITE-ProRule annotation
Glycosylationi67 – 671N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi73 ↔ 89PROSITE-ProRule annotation
Disulfide bondi92 ↔ 107PROSITE-ProRule annotation
Disulfide bondi95 ↔ 115PROSITE-ProRule annotation
Glycosylationi106 – 1061N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi117 ↔ 130PROSITE-ProRule annotation
Disulfide bondi138 ↔ 155PROSITE-ProRule annotation
Disulfide bondi141 ↔ 162PROSITE-ProRule annotation
Disulfide bondi165 ↔ 176PROSITE-ProRule annotation
Disulfide bondi179 ↔ 191PROSITE-ProRule annotation
Disulfide bondi187 ↔ 195PROSITE-ProRule annotation

Post-translational modificationi

Glycosylated.Curated

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ93038.
PRIDEiQ93038.

Expressioni

Tissue specificityi

Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.

Gene expression databases

BgeeiQ93038.
ExpressionAtlasiQ93038. baseline and differential.
GenevestigatoriQ93038.

Interactioni

Subunit structurei

Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4.1 Publication

Protein-protein interaction databases

BioGridi114258. 10 interactions.
DIPiDIP-59563N.

Structurei

3D structure databases

ProteinModelPortaliQ93038.
SMRiQ93038. Positions 40-179, 335-413.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini25 – 199175ExtracellularSequence AnalysisAdd
BLAST
Topological domaini221 – 417197CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei200 – 22021HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati34 – 7138TNFR-Cys 1Add
BLAST
Repeati72 – 11544TNFR-Cys 2Add
BLAST
Repeati116 – 16348TNFR-Cys 3Add
BLAST
Repeati164 – 19229TNFR-Cys 4Add
BLAST
Domaini332 – 41382DeathPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 death domain.PROSITE-ProRule annotation
Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG25022.
GeneTreeiENSGT00530000064001.
HOVERGENiHBG058493.
InParanoidiQ93038.
KOiK05160.
OMAiPGPQLYD.
OrthoDBiEOG744T9K.
PhylomeDBiQ93038.
TreeFamiTF333916.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR022329. TNFR_25.
[Graphical view]
PfamiPF00531. Death. 1 hit.
[Graphical view]
PRINTSiPR01972. TNFACTORR25.
SMARTiSM00005. DEATH. 1 hit.
SM00208. TNFR. 2 hits.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50017. DEATH_DOMAIN. 1 hit.
PS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q93038) [UniParc]FASTAAdd to Basket

Also known as: WSL-1, LARD-1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQRPRGCAA VAAALLLVLL GARAQGGTRS PRCDCAGDFH KKIGLFCCRG
60 70 80 90 100
CPAGHYLKAP CTEPCGNSTC LVCPQDTFLA WENHHNSECA RCQACDEQAS
110 120 130 140 150
QVALENCSAV ADTRCGCKPG WFVECQVSQC VSSSPFYCQP CLDCGALHRH
160 170 180 190 200
TRLLCSRRDT DCGTCLPGFY EHGDGCVSCP TSTLGSCPER CAAVCGWRQM
210 220 230 240 250
FWVQVLLAGL VVPLLLGATL TYTYRHCWPH KPLVTADEAG MEALTPPPAT
260 270 280 290 300
HLSPLDSAHT LLAPPDSSEK ICTVQLVGNS WTPGYPETQE ALCPQVTWSW
310 320 330 340 350
DQLPSRALGP AAAPTLSPES PAGSPAMMLQ PGPQLYDVMD AVPARRWKEF
360 370 380 390 400
VRTLGLREAE IEAVEVEIGR FRDQQYEMLK RWRQQQPAGL GAVYAALERM
410
GLDGCVEDLR SRLQRGP
Length:417
Mass (Da):45,385
Last modified:November 1, 1997 - v2
Checksum:i5226319DFDB46706
GO
Isoform 2 (identifier: Q93038-2) [UniParc]FASTAAdd to Basket

Also known as: LARD-1B

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: A → AA

Show »
Length:418
Mass (Da):45,456
Checksum:i54B48F8B35C620E2
GO
Isoform 3 (identifier: Q93038-3) [UniParc]FASTAAdd to Basket

Also known as: WSL-S1, LARD-3

The sequence of this isoform differs from the canonical sequence as follows:
     182-218: STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA → VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR
     219-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:218
Mass (Da):23,198
Checksum:i9B416919AFA442F6
GO
Isoform 4 (identifier: Q93038-4) [UniParc]FASTAAdd to Basket

Also known as: WSL-S2, LARD-2

The sequence of this isoform differs from the canonical sequence as follows:
     200-253: MFWVQVLLAG...LTPPPATHLS → SRWCAGNARG...LWSPSCLGPP
     254-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:253
Mass (Da):27,004
Checksum:i50A06775B68FC3D7
GO
Isoform 5 (identifier: Q93038-5) [UniParc]FASTAAdd to Basket

Also known as: LARD-4, LARD-11

The sequence of this isoform differs from the canonical sequence as follows:
     182-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:181
Mass (Da):19,432
Checksum:i59AAFEDBBB46E369
GO
Isoform 6 (identifier: Q93038-6) [UniParc]FASTAAdd to Basket

Also known as: LARD-5

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     182-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:136
Mass (Da):14,439
Checksum:i6846913006EEE40A
GO
Isoform 7 (identifier: Q93038-7) [UniParc]FASTAAdd to Basket

Also known as: LARD-6

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     156-171: SRRDTDCGTCLPGFYE → HPSVTLGQRPHPSSTS
     172-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:126
Mass (Da):13,349
Checksum:iEBAC98D7FB3EDB68
GO
Isoform 8 (identifier: Q93038-8) [UniParc]FASTAAdd to Basket

Also known as: LARD-7

The sequence of this isoform differs from the canonical sequence as follows:
     54-236: Missing.

Show »
Length:234
Mass (Da):25,373
Checksum:iD082A4552EDF7531
GO
Isoform 9 (identifier: Q93038-9) [UniParc]FASTAAdd to Basket

Also known as: LARD-8

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.

Show »
Length:372
Mass (Da):40,391
Checksum:iD4F87353AB7F40F6
GO
Isoform 10 (identifier: Q93038-10) [UniParc]FASTAAdd to Basket

Also known as: LARD-9

The sequence of this isoform differs from the canonical sequence as follows:
     200-237: MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD → N

Show »
Length:380
Mass (Da):41,193
Checksum:iED19B586ADD947B7
GO
Isoform 11 (identifier: Q93038-11) [UniParc]FASTAAdd to Basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     182-200: STLGSCPERCAAVCGWRQM → PPPSLAGAPWGAVQSAVPLSVAGGRVGV

Show »
Length:426
Mass (Da):45,928
Checksum:i292A9B2899F3AE1F
GO
Isoform 12 (identifier: Q93038-12) [UniParc]FASTAAdd to Basket

Also known as: Beta soluble

The sequence of this isoform differs from the canonical sequence as follows:
     182-277: STLGSCPERC...SEKICTVQLV → PPPSLAGAPW...LASQAPGYCR
     278-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:277
Mass (Da):29,111
Checksum:i3D19F3E847BFC093
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti4 – 63RPR → AAA in AAC51192. (PubMed:9052839)Curated
Sequence conflicti4 – 63RPR → AAA in AAC51193. (PubMed:9052839)Curated
Sequence conflicti60 – 601P → H in AAB41435. 1 PublicationCurated
Sequence conflicti167 – 1671P → L(PubMed:9052839)Curated
Sequence conflicti167 – 1671P → L1 PublicationCurated
Sequence conflicti312 – 3121A → R(PubMed:8934525)Curated
Sequence conflicti312 – 3121A → R(PubMed:9446802)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti23 – 231R → Q.1 Publication
Corresponds to variant rs35771371 [ dbSNP | Ensembl ].
VAR_018826
Natural varianti159 – 1591D → G.2 Publications
Corresponds to variant rs11800462 [ dbSNP | Ensembl ].
VAR_018827
Natural varianti254 – 2541P → R.1 Publication
Corresponds to variant rs34529016 [ dbSNP | Ensembl ].
VAR_018828
Natural varianti370 – 3701R → L.
Corresponds to variant rs1064590 [ dbSNP | Ensembl ].
VAR_011814
Natural varianti381 – 3811R → H.
Corresponds to variant rs1059333 [ dbSNP | Ensembl ].
VAR_011815

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei54 – 236183Missing in isoform 8. 1 PublicationVSP_006492Add
BLAST
Alternative sequencei54 – 9845Missing in isoform 6, isoform 7 and isoform 9. 1 PublicationVSP_006491Add
BLAST
Alternative sequencei156 – 17116SRRDT…PGFYE → HPSVTLGQRPHPSSTS in isoform 7. 1 PublicationVSP_006493Add
BLAST
Alternative sequencei172 – 417246Missing in isoform 7. 1 PublicationVSP_006494Add
BLAST
Alternative sequencei182 – 417236Missing in isoform 5 and isoform 6. 1 PublicationVSP_006495Add
BLAST
Alternative sequencei182 – 27796STLGS…TVQLV → PPPSLAGAPWGAVQSAVPLS VAGGRVGGVLGMRVGELGWT EGRRVRRGATTQHPPAAFSV LGPGAPGWPCGPPPAWGHPD LHIPPLLASQAPGYCR in isoform 12. 1 PublicationVSP_006499Add
BLAST
Alternative sequencei182 – 21837STLGS…LLLGA → VLGPGAPGWPCGPPPAWGHP DLHIPPLLASQAPGYCR in isoform 3. 2 PublicationsVSP_006497Add
BLAST
Alternative sequencei182 – 20019STLGS…GWRQM → PPPSLAGAPWGAVQSAVPLS VAGGRVGV in isoform 11. 1 PublicationVSP_006496Add
BLAST
Alternative sequencei200 – 25354MFWVQ…ATHLS → SRWCAGNARGRTGMDRGEAG EEGGNHPTPTSCFQCSGSRC SWLALWSPSCLGPP in isoform 4. 2 PublicationsVSP_006501Add
BLAST
Alternative sequencei200 – 23738MFWVQ…LVTAD → N in isoform 10. 2 PublicationsVSP_006503Add
BLAST
Alternative sequencei219 – 417199Missing in isoform 3. 2 PublicationsVSP_006498Add
BLAST
Alternative sequencei236 – 2361A → AA in isoform 2. 1 PublicationVSP_006504
Alternative sequencei254 – 417164Missing in isoform 4. 2 PublicationsVSP_006502Add
BLAST
Alternative sequencei278 – 417140Missing in isoform 12. 1 PublicationVSP_006500Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y09392 mRNA. Translation: CAA70561.1.
Y09392 mRNA. Translation: CAA70559.1.
Y09392 mRNA. Translation: CAA70560.1.
U72763 mRNA. Translation: AAC50819.1.
U83599 Genomic DNA. Translation: AAB41434.1.
U83600 Genomic DNA. Translation: AAB41435.1.
U78029 mRNA. Translation: AAB40918.1.
U74611 mRNA. Translation: AAB39714.1.
U94501 mRNA. Translation: AAC51306.1.
U94504 mRNA. Translation: AAC51309.1.
U94502 mRNA. Translation: AAC51307.1.
U94503 mRNA. Translation: AAC51308.1.
U94505 mRNA. Translation: AAC51310.1.
U94506 mRNA. Translation: AAC51311.1.
U94507 mRNA. Translation: AAC51312.1.
U94508 mRNA. Translation: AAC51313.1.
U94509 mRNA. Translation: AAC51314.1.
U94510 mRNA. Translation: AAC51315.1.
U94512 mRNA. Translation: AAC51316.1.
U83598 mRNA. Translation: AAB41433.1.
AF026070 mRNA. Translation: AAC39556.1.
AF026071 mRNA. Translation: AAB82288.1.
AB051850 Genomic DNA. Translation: BAB40662.1.
AB051851 Genomic DNA. Translation: BAB40663.1.
AY358309 mRNA. Translation: AAQ88676.1.
AY254324 Genomic DNA. Translation: AAO63495.1.
U75380 mRNA. Translation: AAC51192.1.
AL158217 Genomic DNA. Translation: CAI22153.1.
AL158217 Genomic DNA. Translation: CAI22154.1.
AL158217 Genomic DNA. Translation: CAI22155.1.
BC117189 mRNA. Translation: AAI17190.1.
BC143886 mRNA. Translation: AAI43887.1.
U75381 mRNA. Translation: AAC51193.1.
U83597 mRNA. Translation: AAB41432.1.
CCDSiCCDS71.1. [Q93038-1]
CCDS72.1. [Q93038-11]
CCDS73.1. [Q93038-10]
CCDS74.1. [Q93038-9]
CCDS75.1. [Q93038-8]
RefSeqiNP_001034753.1. NM_001039664.1. [Q93038-5]
NP_003781.1. NM_003790.2. [Q93038-1]
NP_683866.1. NM_148965.1. [Q93038-11]
NP_683867.1. NM_148966.1. [Q93038-10]
NP_683868.1. NM_148967.1. [Q93038-9]
NP_683871.1. NM_148970.1. [Q93038-8]
UniGeneiHs.462529.

Genome annotation databases

EnsembliENST00000348333; ENSP00000314451; ENSG00000215788. [Q93038-9]
ENST00000351748; ENSP00000326762; ENSG00000215788. [Q93038-8]
ENST00000351959; ENSP00000337713; ENSG00000215788. [Q93038-10]
ENST00000356876; ENSP00000349341; ENSG00000215788. [Q93038-1]
ENST00000377782; ENSP00000367013; ENSG00000215788. [Q93038-11]
ENST00000414040; ENSP00000404274; ENSG00000215788. [Q93038-3]
ENST00000480393; ENSP00000434129; ENSG00000215788.
ENST00000485036; ENSP00000431554; ENSG00000215788. [Q93038-12]
ENST00000502588; ENSP00000423121; ENSG00000215788. [Q93038-6]
ENST00000502730; ENSP00000421976; ENSG00000215788. [Q93038-7]
ENST00000510563; ENSP00000424071; ENSG00000215788. [Q93038-5]
GeneIDi8718.
KEGGihsa:8718.
UCSCiuc001ana.3. human. [Q93038-8]
uc001ane.3. human. [Q93038-1]
uc001anf.3. human. [Q93038-10]
uc001ang.3. human. [Q93038-9]
uc001anh.3. human. [Q93038-11]
uc001ani.1. human. [Q93038-5]

Polymorphism databases

DMDMi2501233.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y09392 mRNA. Translation: CAA70561.1 .
Y09392 mRNA. Translation: CAA70559.1 .
Y09392 mRNA. Translation: CAA70560.1 .
U72763 mRNA. Translation: AAC50819.1 .
U83599 Genomic DNA. Translation: AAB41434.1 .
U83600 Genomic DNA. Translation: AAB41435.1 .
U78029 mRNA. Translation: AAB40918.1 .
U74611 mRNA. Translation: AAB39714.1 .
U94501 mRNA. Translation: AAC51306.1 .
U94504 mRNA. Translation: AAC51309.1 .
U94502 mRNA. Translation: AAC51307.1 .
U94503 mRNA. Translation: AAC51308.1 .
U94505 mRNA. Translation: AAC51310.1 .
U94506 mRNA. Translation: AAC51311.1 .
U94507 mRNA. Translation: AAC51312.1 .
U94508 mRNA. Translation: AAC51313.1 .
U94509 mRNA. Translation: AAC51314.1 .
U94510 mRNA. Translation: AAC51315.1 .
U94512 mRNA. Translation: AAC51316.1 .
U83598 mRNA. Translation: AAB41433.1 .
AF026070 mRNA. Translation: AAC39556.1 .
AF026071 mRNA. Translation: AAB82288.1 .
AB051850 Genomic DNA. Translation: BAB40662.1 .
AB051851 Genomic DNA. Translation: BAB40663.1 .
AY358309 mRNA. Translation: AAQ88676.1 .
AY254324 Genomic DNA. Translation: AAO63495.1 .
U75380 mRNA. Translation: AAC51192.1 .
AL158217 Genomic DNA. Translation: CAI22153.1 .
AL158217 Genomic DNA. Translation: CAI22154.1 .
AL158217 Genomic DNA. Translation: CAI22155.1 .
BC117189 mRNA. Translation: AAI17190.1 .
BC143886 mRNA. Translation: AAI43887.1 .
U75381 mRNA. Translation: AAC51193.1 .
U83597 mRNA. Translation: AAB41432.1 .
CCDSi CCDS71.1. [Q93038-1 ]
CCDS72.1. [Q93038-11 ]
CCDS73.1. [Q93038-10 ]
CCDS74.1. [Q93038-9 ]
CCDS75.1. [Q93038-8 ]
RefSeqi NP_001034753.1. NM_001039664.1. [Q93038-5 ]
NP_003781.1. NM_003790.2. [Q93038-1 ]
NP_683866.1. NM_148965.1. [Q93038-11 ]
NP_683867.1. NM_148966.1. [Q93038-10 ]
NP_683868.1. NM_148967.1. [Q93038-9 ]
NP_683871.1. NM_148970.1. [Q93038-8 ]
UniGenei Hs.462529.

3D structure databases

ProteinModelPortali Q93038.
SMRi Q93038. Positions 40-179, 335-413.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114258. 10 interactions.
DIPi DIP-59563N.

Chemistry

GuidetoPHARMACOLOGYi 1883.

Polymorphism databases

DMDMi 2501233.

Proteomic databases

PaxDbi Q93038.
PRIDEi Q93038.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000348333 ; ENSP00000314451 ; ENSG00000215788 . [Q93038-9 ]
ENST00000351748 ; ENSP00000326762 ; ENSG00000215788 . [Q93038-8 ]
ENST00000351959 ; ENSP00000337713 ; ENSG00000215788 . [Q93038-10 ]
ENST00000356876 ; ENSP00000349341 ; ENSG00000215788 . [Q93038-1 ]
ENST00000377782 ; ENSP00000367013 ; ENSG00000215788 . [Q93038-11 ]
ENST00000414040 ; ENSP00000404274 ; ENSG00000215788 . [Q93038-3 ]
ENST00000480393 ; ENSP00000434129 ; ENSG00000215788 .
ENST00000485036 ; ENSP00000431554 ; ENSG00000215788 . [Q93038-12 ]
ENST00000502588 ; ENSP00000423121 ; ENSG00000215788 . [Q93038-6 ]
ENST00000502730 ; ENSP00000421976 ; ENSG00000215788 . [Q93038-7 ]
ENST00000510563 ; ENSP00000424071 ; ENSG00000215788 . [Q93038-5 ]
GeneIDi 8718.
KEGGi hsa:8718.
UCSCi uc001ana.3. human. [Q93038-8 ]
uc001ane.3. human. [Q93038-1 ]
uc001anf.3. human. [Q93038-10 ]
uc001ang.3. human. [Q93038-9 ]
uc001anh.3. human. [Q93038-11 ]
uc001ani.1. human. [Q93038-5 ]

Organism-specific databases

CTDi 8718.
GeneCardsi GC01M006521.
HGNCi HGNC:11910. TNFRSF25.
MIMi 603366. gene.
neXtProti NX_Q93038.
PharmGKBi PA36603.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG25022.
GeneTreei ENSGT00530000064001.
HOVERGENi HBG058493.
InParanoidi Q93038.
KOi K05160.
OMAi PGPQLYD.
OrthoDBi EOG744T9K.
PhylomeDBi Q93038.
TreeFami TF333916.

Miscellaneous databases

GeneWikii TNFRSF25.
GenomeRNAii 8718.
NextBioi 32691.
PROi Q93038.
SOURCEi Search...

Gene expression databases

Bgeei Q93038.
ExpressionAtlasi Q93038. baseline and differential.
Genevestigatori Q93038.

Family and domain databases

Gene3Di 1.10.533.10. 1 hit.
InterProi IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR022329. TNFR_25.
[Graphical view ]
Pfami PF00531. Death. 1 hit.
[Graphical view ]
PRINTSi PR01972. TNFACTORR25.
SMARTi SM00005. DEATH. 1 hit.
SM00208. TNFR. 2 hits.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 1 hit.
PROSITEi PS50017. DEATH_DOMAIN. 1 hit.
PS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), MUTAGENESIS.
    Tissue: Lymphoid tissue.
  2. "Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95."
    Chinnaiyan A.M., O'Rourke K., Yu G.-L., Lyons R.H., Garg M., Duan D.R., Xing L., Gentz R., Ni J., Dixit V.M.
    Science 274:990-992(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Umbilical vein endothelial cell.
  3. Degli-Esposti M.A., Din W.S., Cosman D., Smith C.A., Goodwin R.G.
    Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  4. "Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa-B."
    Marsters S.A., Sheridan J.P., Donahue C.J., Pitti R.M., Gray C.L., Goddard A.D., Bauer K.D., Ashkenazi A.
    Curr. Biol. 6:1669-1676(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  5. "LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing."
    Screaton G.R., Xu X.-N., Olsen A.L., Cowper A.E., Tan R., McMichael A.J., Bell J.I.
    Proc. Natl. Acad. Sci. U.S.A. 94:4615-4619(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
  6. "A new death receptor 3 isoform: expression in human lymphoid cell lines and non-Hodgkin's lymphomas."
    Warzocha K., Ribeiro P., Charlot C., Renard N., Coiffier B., Salles G.
    Biochem. Biophys. Res. Commun. 242:376-379(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 11 AND 12).
  7. Shiozawa S., Konishi Y., Murayama K., Mukae N., Yamamoto E., Hayashi S., Sato M., Shiozawa K., Tsukamoto Y.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLY-159.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. NIEHS SNPs program
    Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-23; GLY-159 AND ARG-254.
  10. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
    Tissue: Brain.
  12. "TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)."
    Bodmer J.-L., Burns K., Schneider P., Hofmann K., Steiner V., Thome M., Bornand T., Hahne M., Schroeter M., Wilson A., French L.E., Browning J.L., Macdonald H.R., Tschopp J.
    Immunity 6:79-88(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-417.
    Tissue: Brain and Fetal lung.
  13. Chaudhary P.M., Hood L.E.
    Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 7-417.
    Tissue: Brain.
  14. "Prevention of constitutive TNF receptor 1 signaling by silencer of death domains."
    Jiang Y., Woronicz J.D., Liu W., Goeddel D.V.
    Science 283:543-546(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BAG4.
  15. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

Entry informationi

Entry nameiTNR25_HUMAN
AccessioniPrimary (citable) accession number: Q93038
Secondary accession number(s): B1ALX2
, B1ALX3, B7ZLL7, O00275, O00276, O00277, O00278, O00279, O00280, O14865, O14866, P78507, P78515, Q17RU4, Q92983, Q93036, Q93037, Q99722, Q99830, Q99831, Q9BY86, Q9UME0, Q9UME1, Q9UME5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: October 29, 2014
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3