Reviewed,
UniProtKB/Swiss-Prot Q92913 (FGF13_HUMAN)
Last modified
November 3, 2009.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Fibroblast growth factor 13 Short name=FGF-13 Alternative name(s): Fibroblast growth factor homologous factor 2 Short name=FHF-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 245 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probably involved in nervous system development and function. |
| Tissue specificity | Nervous system. |
| Sequence similarities | Belongs to the heparin-binding growth factors family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Growth factor |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | MAPKKK cascade Inferred from direct assay. Source: MGI cell-cell signaling Ref.1Traceable author statement. Source: ProtInc nervous system development Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from physical interaction. Source: MGI nucleus Ref.1Inferred from direct assay. Source: MGI |
| Molecular function | growth factor activity Ref.1 Traceable author statement. Source: ProtInc protein kinase activator activityInferred from genetic interaction. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1A (identifier: Q92913-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1B (identifier: Q92913-2) The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 245 | 245 | Fibroblast growth factor 13 | PRO_0000147607 | ||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MALLRKSYS in isoform 1B. | VSP_001529 | ||||||||||||||||||||||||||
| Natural variant | 197 | 1 | K → Q | VAR_020945 | ||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 70 – 75 | 6 | ||||||||||||||||||||||||||||
| Helix | 98 – 100 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 102 – 106 | 5 | ||||||||||||||||||||||||||||
| Beta strand | 111 – 115 | 5 | ||||||||||||||||||||||||||||
| Beta strand | 122 – 125 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 131 – 137 | 7 | ||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 142 – 148 | 7 | ||||||||||||||||||||||||||||
| Turn | 149 – 151 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 152 – 159 | 8 | ||||||||||||||||||||||||||||
| Helix | 190 – 192 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 194 – 200 | 7 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed: 8790420] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). Tissue: Retina. |
| [2] | "Fibroblast growth factor homologous factor 2 (FHF2): gene structure, expression and mapping to the Borjeson-Forssman-Lehmann syndrome region in Xq26 delineated by a duplication breakpoint in a BFLS-like patient." Gecz J., Baker E., Donnelly A., Ming J.E., McDonnald-McGinn D.M., Spinner N.B., Zackai E.H., Sutherland G.R., Mulley J.C. Hum. Genet. 104:56-63(1999) [PubMed: 10071193] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A AND 1B). Tissue: Brain. |
| [3] | NIEHS SNPs program Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLN-197. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A). Tissue: Lung and Skin. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U66198 mRNA. Translation: AAB18914.1. AF100143 mRNA. Translation: AAD16400.1. AF100144 mRNA. Translation: AAD16401.1. AY672645 Genomic DNA. Translation: AAT70720.1. BC012347 mRNA. Translation: AAH12347.1. BC034340 mRNA. Translation: AAH34340.1. | |||||||||||||
| IPI | IPI00024251. IPI00066574. | ||||||||||||
| RefSeq | NP_001132970.1. NP_001132972.1. NP_001132973.1. NP_001132974.1. NP_004105.1. NP_378668.1. | ||||||||||||
| UniGene | Hs.6540 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | Q92913. Positions 64-201. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q92913. 1 interaction. | ||||||||||||
| STRING | Q92913. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q92913. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000305414; ENSP00000303391; ENSG00000129682; Homo sapiens. [Genome view] ENST00000315930; ENSP00000322390; ENSG00000129682; Homo sapiens. [Genome view] ENST00000370603; ENSP00000359635; ENSG00000129682; Homo sapiens. [Genome view] ENST00000421460; ENSP00000388688; ENSG00000129682; Homo sapiens. [Genome view] ENST00000436198; ENSP00000396198; ENSG00000129682; Homo sapiens. [Genome view] ENST00000441825; ENSP00000409276; ENSG00000129682; Homo sapiens. [Genome view] ENST00000448673; ENSP00000411999; ENSG00000129682; Homo sapiens. [Genome view] ENST00000455663; ENSP00000406916; ENSG00000129682; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 2258. | ||||||||||||
| KEGG | hsa:2258. | ||||||||||||
| UCSC | uc004fam.1. human. uc004fan.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2258. | ||||||||||||
| GeneCards | GC0XM137541. | ||||||||||||
| H-InvDB | HIX0017088. | ||||||||||||
| HGNC | HGNC:3670. FGF13. | ||||||||||||
| HPA | HPA002809. | ||||||||||||
| MIM | 300070. gene. | ||||||||||||
| PharmGKB | PA28109. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q92913. | ||||||||||||
| OMA | VCELAVP. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q92913. | ||||||||||||
| Bgee | Q92913. | ||||||||||||
| CleanEx | HS_FGF13. | ||||||||||||
| Genevestigator | Q92913. | ||||||||||||
| GermOnline | ENSG00000129682. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR002209. GF_heparin_bd. IPR002348. IL1_HBGF. [Graphical view] | ||||||||||||
| PANTHER | PTHR11486. IL1_HBGF. 1 hit. | ||||||||||||
| Pfam | PF00167. FGF. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00263. HBGFFGF. PR00262. IL1HBGF. | ||||||||||||
| ProDom | PD000831. IL1_HBGF. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| SMART | SM00442. FGF. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00247. HBGF_FGF. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 9149. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FGF13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92913 Secondary accession number(s): O95830 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


