Q92913 (FGF13_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibroblast growth factor 13 Short name=FGF-13 Alternative name(s): Fibroblast growth factor homologous factor 2 Short name=FHF-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 245 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. Ref.11 May regulate voltage-gated sodium channels transport and function. Ref.11 May also play a role in MAPK signaling. Ref.11 |
| Subunit structure | Interacts with SCN8A; may regulate SCN8A activity. Interacts with SCN1A; may regulate SCN1A activity. Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. May also interact with SCN2A and SCN11A. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity. Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 |
| Subcellular location | Cell projection › filopodium By similarity. Cell projection › growth cone By similarity. Cell projection › dendrite By similarity. Nucleus Ref.8. Cytoplasm. Note: Not secreted By similarity. Ref.8 |
| Tissue specificity | Ubiquitously expressed. Predominantly expressed in the nervous system. Ref.9 |
| Post-translational modification | May be phosphorylated By similarity. |
| Sequence similarities | Belongs to the heparin-binding growth factors family. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92913-1) Also known as: FGF13A; 1A; hFHF-2(1S); FGF13S; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92913-2) Also known as: FGF13B; 1B; hFHF-2(1U); FGF13U; The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS | ||||||
| Isoform 3 (identifier: Q92913-3) Also known as: hFHF-2(1Y+1V); FGF13YV; The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKE...VHHKENTEPE | ||||||
| Isoform 4 (identifier: Q92913-4) Also known as: hFHF-2(1Z+1Y); FGF13V; The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKEEKDASK | ||||||
| Isoform 5 (identifier: Q92913-5) Also known as: hFHF-2(1X+1W+1V); FGF13Y; The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLI...GSKKRRRRRP → MLRQDSIQSA...VHHKENTEPE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 245 | 245 | Fibroblast growth factor 13 | PRO_0000147607 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 62 | 62 | Mediates targeting to the nucleus By similarity | |||||||||||||||||||||||||||||||||||||||||
| Region | 67 – 201 | 135 | Mediates interaction with sodium channels | |||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MALLRKSYS in isoform 2. | VSP_001529 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPL KQVHHKENTEPE in isoform 3. | VSP_043461 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MSGKVTKPKEEKDASK in isoform 4. | VSP_043460 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MLRQDSIQSAELKKKESPFR AKCHEIFCCPLKQVHHKENT EPE in isoform 5. | VSP_044129 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 197 | 1 | K → Q. Ref.4 Corresponds to variant rs17510270 [ dbSNP | Ensembl ]. | VAR_020945 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 207 | 1 | P → Q: Loss of interaction with SCN1A. Ref.13 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 75 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 76 – 78 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 80 – 83 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 93 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 100 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 108 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 111 – 116 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 117 – 119 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 122 – 125 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 131 – 137 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 148 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 149 – 151 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 161 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 163 – 165 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 168 – 170 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 179 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 192 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 204 | 11 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Retina. |
| [2] | "Fibroblast growth factor homologous factor 2 (FHF2): gene structure, expression and mapping to the Borjeson-Forssman-Lehmann syndrome region in Xq26 delineated by a duplication breakpoint in a BFLS-like patient." Gecz J., Baker E., Donnelly A., Ming J.E., McDonnald-McGinn D.M., Spinner N.B., Zackai E.H., Sutherland G.R., Mulley J.C. Hum. Genet. 104:56-63(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain and Kidney. |
| [4] | NIEHS SNPs program Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLN-197. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Skin. |
| [8] | "Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing." Munoz-Sanjuan I., Smallwood P.M., Nathans J. J. Biol. Chem. 275:2589-2597(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION. |
| [9] | "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart." Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M. Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Fibroblast growth factor homologous factors are intracellular signaling proteins." Schoorlemmer J., Goldfarb M. Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAPK8IP2. |
| [11] | "Fibroblast growth factor homologous factor 2B: association with Nav1.6 and selective colocalization at nodes of Ranvier of dorsal root axons." Wittmack E.K., Rush A.M., Craner M.J., Goldfarb M., Waxman S.G., Dib-Hajj S.D. J. Neurosci. 24:6765-6775(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN SCN8A REGULATION, INTERACTION WITH SCN8A. |
| [12] | "Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts." Wang C., Hennessey J.A., Kirkton R.D., Wang C., Graham V., Puranam R.S., Rosenberg P.B., Bursac N., Pitt G.S. Circ. Res. 109:775-782(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SCN5A. |
| [13] | "Identification of novel interaction sites that determine specificity between fibroblast growth factor homologous factors and voltage-gated sodium channels." Wang C., Wang C., Hoch E.G., Pitt G.S. J. Biol. Chem. 286:24253-24263(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SCN1A; SCN2A; SCN5A AND SCN8A, MUTAGENESIS OF PRO-207. |
| [14] | "Crystal structure of a fibroblast growth factor homologous factor (FHF) defines a conserved surface on FHFs for binding and modulation of voltage-gated sodium channels." Goetz R., Dover K., Laezza F., Shtraizent N., Huang X., Tchetchik D., Eliseenkova A.V., Xu C.F., Neubert T.A., Ornitz D.M., Goldfarb M., Mohammadi M. J. Biol. Chem. 284:17883-17896(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 53-245, INTERACTION WITH SCN1A; SCN11A; SCN2A AND SCN5A. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U66198 mRNA. Translation: AAB18914.1. AF100143 mRNA. Translation: AAD16400.1. AF100144 mRNA. Translation: AAD16401.1. AK297545 mRNA. Translation: BAH12613.1. AK303685 mRNA. Translation: BAH14016.1. AK316170 mRNA. Translation: BAH14541.1. AY672645 Genomic DNA. Translation: AAT70720.1. AL031386, Z82193 Genomic DNA. Translation: CAI95616.1. Z82193, AL031386 Genomic DNA. Translation: CAI95677.1. Z81007 Genomic DNA. No translation available. Z82204 Genomic DNA. Translation: CAI42696.1. Z83313 Genomic DNA. No translation available. AL023798 Genomic DNA. No translation available. AL023800 Genomic DNA. No translation available. AL034398 Genomic DNA. No translation available. AL034416 Genomic DNA. No translation available. CH471150 Genomic DNA. Translation: EAW88435.1. CH471150 Genomic DNA. Translation: EAW88438.1. CH471150 Genomic DNA. Translation: EAW88440.1. BC012347 mRNA. Translation: AAH12347.1. BC034340 mRNA. Translation: AAH34340.1. AF199612 mRNA. Translation: AAF31399.1. AF199613 mRNA. Translation: AAF31400.1. | ||||||||||||||||||
| IPI | IPI00024251. IPI00066574. IPI00552653. IPI00915279. IPI00915358. | ||||||||||||||||||
| RefSeq | NP_001132970.1. NM_001139498.1. NP_001132972.1. NM_001139500.1. NP_001132973.1. NM_001139501.1. NP_001132974.1. NM_001139502.1. NP_004105.1. NM_004114.3. NP_378668.1. NM_033642.2. | ||||||||||||||||||
| UniGene | Hs.6540. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q92913. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-50447N. | ||||||||||||||||||
| IntAct | Q92913. 1 interaction. | ||||||||||||||||||
| STRING | 9606.ENSP00000322390. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q92913. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 2494461. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q92913. | ||||||||||||||||||
| PRIDE | Q92913. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 2258. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000305414; ENSP00000303391; ENSG00000129682. ENST00000315930; ENSP00000322390; ENSG00000129682. ENST00000370603; ENSP00000359635; ENSG00000129682. ENST00000421460; ENSP00000388688; ENSG00000129682. ENST00000441825; ENSP00000409276; ENSG00000129682. ENST00000541469; ENSP00000437903; ENSG00000129682. | ||||||||||||||||||
| GeneID | 2258. | ||||||||||||||||||
| KEGG | hsa:2258. | ||||||||||||||||||
| UCSC | uc004fam.3. human. uc004fan.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 2258. | ||||||||||||||||||
| GeneCards | GC0XM137713. | ||||||||||||||||||
| HGNC | HGNC:3670. FGF13. | ||||||||||||||||||
| HPA | HPA002809. | ||||||||||||||||||
| MIM | 300070. gene. | ||||||||||||||||||
| neXtProt | NX_Q92913. | ||||||||||||||||||
| PharmGKB | PA28109. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG308177. | ||||||||||||||||||
| HOGENOM | HOG000290676. | ||||||||||||||||||
| HOVERGEN | HBG007580. | ||||||||||||||||||
| KO | K04358. | ||||||||||||||||||
| OMA | EEDSTYT. | ||||||||||||||||||
| OrthoDB | EOG4VQ9Q2. | ||||||||||||||||||
| PhylomeDB | Q92913. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q92913. | ||||||||||||||||||
| Bgee | Q92913. | ||||||||||||||||||
| CleanEx | HS_FGF13. | ||||||||||||||||||
| Genevestigator | Q92913. | ||||||||||||||||||
| GermOnline | ENSG00000129682. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008996. Cytokine_IL1-like. IPR002209. GF_heparin-bd. IPR002348. IL1_HBGF. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR11486. PTHR11486. 1 hit. | ||||||||||||||||||
| Pfam | PF00167. FGF. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00263. HBGFFGF. PR00262. IL1HBGF. | ||||||||||||||||||
| SMART | SM00442. FGF. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. | ||||||||||||||||||
| PROSITE | PS00247. HBGF_FGF. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | FGF13. human. | ||||||||||||||||||
| EvolutionaryTrace | Q92913. | ||||||||||||||||||
| GenomeRNAi | 2258. | ||||||||||||||||||
| NextBio | 9149. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | FGF13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92913 Secondary accession number(s): B1AK18 Q9NZI0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
