Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92913

- FGF13_HUMAN

UniProt

Q92913 - FGF13_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibroblast growth factor 13

Gene

FGF13

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.1 Publication
May regulate voltage-gated sodium channels transport and function.1 Publication
May also play a role in MAPK signaling.1 Publication

GO - Molecular functioni

  1. beta-tubulin binding Source: UniProtKB
  2. growth factor activity Source: ProtInc
  3. ion channel binding Source: UniProtKB
  4. microtubule binding Source: UniProtKB
  5. protein kinase activator activity Source: MGI
  6. sodium channel regulator activity Source: UniProtKB

GO - Biological processi

  1. cell-cell signaling Source: ProtInc
  2. cerebral cortex cell migration Source: UniProtKB
  3. establishment of neuroblast polarity Source: UniProtKB
  4. hippocampus development Source: UniProtKB
  5. learning Source: UniProtKB
  6. MAPK cascade Source: MGI
  7. memory Source: UniProtKB
  8. microtubule polymerization Source: UniProtKB
  9. negative regulation of collateral sprouting Source: UniProtKB
  10. negative regulation of microtubule depolymerization Source: UniProtKB
  11. nervous system development Source: ProtInc
  12. neuron migration Source: UniProtKB
  13. positive regulation of protein kinase activity Source: GOC
  14. protein localization to plasma membrane Source: UniProtKB
  15. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Neurogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 13
Short name:
FGF-13
Alternative name(s):
Fibroblast growth factor homologous factor 2
Short name:
FHF-2
Gene namesi
Name:FGF13
Synonyms:FHF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:3670. FGF13.

Subcellular locationi

Cell projectionfilopodium By similarity. Cell projectiongrowth cone By similarity. Cell projectiondendrite By similarity. Nucleus 1 Publication. Cytoplasm 1 Publication
Note: Not secreted.By similarity

GO - Cellular componenti

  1. axon Source: UniProtKB
  2. cytoplasm Source: HPA
  3. dendrite Source: UniProtKB
  4. extracellular region Source: InterPro
  5. filopodium Source: UniProtKB
  6. growth cone Source: UniProtKB
  7. intercalated disc Source: UniProtKB
  8. microtubule Source: UniProtKB
  9. neuron projection Source: UniProtKB
  10. nucleus Source: MGI
  11. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Microtubule, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi207 – 2071P → Q: Loss of interaction with SCN1A. 1 Publication

Organism-specific databases

PharmGKBiPA28109.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 245245Fibroblast growth factor 13PRO_0000147607Add
BLAST

Post-translational modificationi

May be phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ92913.
PRIDEiQ92913.

PTM databases

PhosphoSiteiQ92913.

Expressioni

Tissue specificityi

Ubiquitously expressed. Predominantly expressed in the nervous system.1 Publication

Gene expression databases

BgeeiQ92913.
CleanExiHS_FGF13.
ExpressionAtlasiQ92913. baseline and differential.
GenevestigatoriQ92913.

Organism-specific databases

HPAiHPA002809.

Interactioni

Subunit structurei

Interacts with SCN8A; may regulate SCN8A activity. Interacts with SCN1A; may regulate SCN1A activity. Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. May also interact with SCN2A and SCN11A. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.5 Publications

Protein-protein interaction databases

BioGridi108549. 3 interactions.
DIPiDIP-50447N.
IntActiQ92913. 1 interaction.
STRINGi9606.ENSP00000322390.

Structurei

Secondary structure

1
245
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi66 – 7510
Turni76 – 783
Beta strandi80 – 834
Beta strandi89 – 935
Helixi98 – 1003
Beta strandi102 – 1087
Beta strandi111 – 1166
Turni117 – 1193
Beta strandi122 – 1254
Beta strandi131 – 1377
Helixi139 – 1413
Beta strandi142 – 1487
Turni149 – 1513
Beta strandi152 – 16110
Turni163 – 1653
Beta strandi168 – 1703
Beta strandi177 – 1793
Helixi182 – 1843
Helixi190 – 1923
Beta strandi194 – 20411

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3HBWX-ray1.90A/B53-245[»]
4DCKX-ray2.20C63-245[»]
4JPZX-ray3.02A/E60-245[»]
ProteinModelPortaliQ92913.
SMRiQ92913. Positions 64-212.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92913.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 6262Mediates targeting to the nucleusBy similarityAdd
BLAST
Regioni67 – 201135Mediates interaction with sodium channelsAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG308177.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiQ92913.
KOiK04358.
OMAiKSNACRC.
OrthoDBiEOG7J447D.
PhylomeDBiQ92913.
TreeFamiTF317805.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92913-1) [UniParc]FASTAAdd to Basket

Also known as: FGF13A, 1A, hFHF-2(1S), FGF13S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK
60 70 80 90 100
LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT
110 120 130 140 150
LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSELFTPE CKFKESVFEN
160 170 180 190 200
YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK
210 220 230 240
VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST
Length:245
Mass (Da):27,564
Last modified:February 1, 1997 - v1
Checksum:i30FB62C6B2669F29
GO
Isoform 2 (identifier: Q92913-2) [UniParc]FASTAAdd to Basket

Also known as: FGF13B, 1B, hFHF-2(1U), FGF13U

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

Show »
Length:192
Mass (Da):21,581
Checksum:i1C5B15BB67B2F232
GO
Isoform 3 (identifier: Q92913-3) [UniParc]FASTAAdd to Basket

Also known as: hFHF-2(1Y+1V), FGF13YV

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKE...VHHKENTEPE

Show »
Length:255
Mass (Da):28,752
Checksum:iADAB4C72927597DC
GO
Isoform 4 (identifier: Q92913-4) [UniParc]FASTAAdd to Basket

Also known as: hFHF-2(1Z+1Y), FGF13V

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKEEKDASK

Show »
Length:199
Mass (Da):22,275
Checksum:iD73D2E43AAA1414F
GO
Isoform 5 (identifier: Q92913-5) [UniParc]FASTAAdd to Basket

Also known as: hFHF-2(1X+1W+1V), FGF13Y

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MLRQDSIQSA...VHHKENTEPE

Show »
Length:226
Mass (Da):25,607
Checksum:i59444607415A4FD0
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti197 – 1971K → Q.1 Publication
Corresponds to variant rs17510270 [ dbSNP | Ensembl ].
VAR_020945

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationVSP_001529Add
BLAST
Alternative sequencei1 – 6262MAAAI…RRRRP → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPL KQVHHKENTEPE in isoform 3. 1 PublicationVSP_043461Add
BLAST
Alternative sequencei1 – 6262MAAAI…RRRRP → MSGKVTKPKEEKDASK in isoform 4. 1 PublicationVSP_043460Add
BLAST
Alternative sequencei1 – 6262MAAAI…RRRRP → MLRQDSIQSAELKKKESPFR AKCHEIFCCPLKQVHHKENT EPE in isoform 5. CuratedVSP_044129Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66198 mRNA. Translation: AAB18914.1.
AF100143 mRNA. Translation: AAD16400.1.
AF100144 mRNA. Translation: AAD16401.1.
AK297545 mRNA. Translation: BAH12613.1.
AK303685 mRNA. Translation: BAH14016.1.
AK316170 mRNA. Translation: BAH14541.1.
AY672645 Genomic DNA. Translation: AAT70720.1.
AL031386, Z82193 Genomic DNA. Translation: CAI95616.1.
Z82193, AL031386 Genomic DNA. Translation: CAI95677.1.
Z81007 Genomic DNA. No translation available.
Z82204 Genomic DNA. Translation: CAI42696.1.
Z83313 Genomic DNA. No translation available.
AL023798 Genomic DNA. No translation available.
AL023800 Genomic DNA. No translation available.
AL034398 Genomic DNA. No translation available.
AL034416 Genomic DNA. No translation available.
CH471150 Genomic DNA. Translation: EAW88435.1.
CH471150 Genomic DNA. Translation: EAW88438.1.
CH471150 Genomic DNA. Translation: EAW88440.1.
BC012347 mRNA. Translation: AAH12347.1.
BC034340 mRNA. Translation: AAH34340.1.
AF199612 mRNA. Translation: AAF31399.1.
AF199613 mRNA. Translation: AAF31400.1.
CCDSiCCDS14664.1. [Q92913-2]
CCDS14665.1. [Q92913-1]
CCDS55511.1. [Q92913-5]
RefSeqiNP_001132970.1. NM_001139498.1. [Q92913-4]
NP_001132972.1. NM_001139500.1. [Q92913-3]
NP_001132973.1. NM_001139501.1. [Q92913-5]
NP_001132974.1. NM_001139502.1. [Q92913-5]
NP_004105.1. NM_004114.3. [Q92913-1]
NP_378668.1. NM_033642.2. [Q92913-2]
XP_005262456.1. XM_005262399.1. [Q92913-3]
UniGeneiHs.6540.

Genome annotation databases

EnsembliENST00000305414; ENSP00000303391; ENSG00000129682. [Q92913-2]
ENST00000315930; ENSP00000322390; ENSG00000129682. [Q92913-1]
ENST00000421460; ENSP00000388688; ENSG00000129682.
ENST00000441825; ENSP00000409276; ENSG00000129682. [Q92913-5]
GeneIDi2258.
KEGGihsa:2258.
UCSCiuc004fam.3. human. [Q92913-1]
uc004fan.3. human. [Q92913-2]
uc004faq.3. human. [Q92913-3]
uc004far.3. human. [Q92913-5]
uc011mwk.2. human. [Q92913-4]

Polymorphism databases

DMDMi2494461.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66198 mRNA. Translation: AAB18914.1 .
AF100143 mRNA. Translation: AAD16400.1 .
AF100144 mRNA. Translation: AAD16401.1 .
AK297545 mRNA. Translation: BAH12613.1 .
AK303685 mRNA. Translation: BAH14016.1 .
AK316170 mRNA. Translation: BAH14541.1 .
AY672645 Genomic DNA. Translation: AAT70720.1 .
AL031386 , Z82193 Genomic DNA. Translation: CAI95616.1 .
Z82193 , AL031386 Genomic DNA. Translation: CAI95677.1 .
Z81007 Genomic DNA. No translation available.
Z82204 Genomic DNA. Translation: CAI42696.1 .
Z83313 Genomic DNA. No translation available.
AL023798 Genomic DNA. No translation available.
AL023800 Genomic DNA. No translation available.
AL034398 Genomic DNA. No translation available.
AL034416 Genomic DNA. No translation available.
CH471150 Genomic DNA. Translation: EAW88435.1 .
CH471150 Genomic DNA. Translation: EAW88438.1 .
CH471150 Genomic DNA. Translation: EAW88440.1 .
BC012347 mRNA. Translation: AAH12347.1 .
BC034340 mRNA. Translation: AAH34340.1 .
AF199612 mRNA. Translation: AAF31399.1 .
AF199613 mRNA. Translation: AAF31400.1 .
CCDSi CCDS14664.1. [Q92913-2 ]
CCDS14665.1. [Q92913-1 ]
CCDS55511.1. [Q92913-5 ]
RefSeqi NP_001132970.1. NM_001139498.1. [Q92913-4 ]
NP_001132972.1. NM_001139500.1. [Q92913-3 ]
NP_001132973.1. NM_001139501.1. [Q92913-5 ]
NP_001132974.1. NM_001139502.1. [Q92913-5 ]
NP_004105.1. NM_004114.3. [Q92913-1 ]
NP_378668.1. NM_033642.2. [Q92913-2 ]
XP_005262456.1. XM_005262399.1. [Q92913-3 ]
UniGenei Hs.6540.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3HBW X-ray 1.90 A/B 53-245 [» ]
4DCK X-ray 2.20 C 63-245 [» ]
4JPZ X-ray 3.02 A/E 60-245 [» ]
ProteinModelPortali Q92913.
SMRi Q92913. Positions 64-212.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108549. 3 interactions.
DIPi DIP-50447N.
IntActi Q92913. 1 interaction.
STRINGi 9606.ENSP00000322390.

PTM databases

PhosphoSitei Q92913.

Polymorphism databases

DMDMi 2494461.

Proteomic databases

PaxDbi Q92913.
PRIDEi Q92913.

Protocols and materials databases

DNASUi 2258.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000305414 ; ENSP00000303391 ; ENSG00000129682 . [Q92913-2 ]
ENST00000315930 ; ENSP00000322390 ; ENSG00000129682 . [Q92913-1 ]
ENST00000421460 ; ENSP00000388688 ; ENSG00000129682 .
ENST00000441825 ; ENSP00000409276 ; ENSG00000129682 . [Q92913-5 ]
GeneIDi 2258.
KEGGi hsa:2258.
UCSCi uc004fam.3. human. [Q92913-1 ]
uc004fan.3. human. [Q92913-2 ]
uc004faq.3. human. [Q92913-3 ]
uc004far.3. human. [Q92913-5 ]
uc011mwk.2. human. [Q92913-4 ]

Organism-specific databases

CTDi 2258.
GeneCardsi GC0XM137713.
HGNCi HGNC:3670. FGF13.
HPAi HPA002809.
MIMi 300070. gene.
neXtProti NX_Q92913.
PharmGKBi PA28109.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG308177.
GeneTreei ENSGT00760000118859.
HOGENOMi HOG000290676.
HOVERGENi HBG007580.
InParanoidi Q92913.
KOi K04358.
OMAi KSNACRC.
OrthoDBi EOG7J447D.
PhylomeDBi Q92913.
TreeFami TF317805.

Miscellaneous databases

ChiTaRSi FGF13. human.
EvolutionaryTracei Q92913.
GeneWikii FGF13.
GenomeRNAii 2258.
NextBioi 9149.
PROi Q92913.
SOURCEi Search...

Gene expression databases

Bgeei Q92913.
CleanExi HS_FGF13.
ExpressionAtlasi Q92913. baseline and differential.
Genevestigatori Q92913.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view ]
PANTHERi PTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PRINTSi PR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTi SM00442. FGF. 1 hit.
[Graphical view ]
SUPFAMi SSF50353. SSF50353. 1 hit.
PROSITEi PS00247. HBGF_FGF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
    Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
    Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Retina.
  2. "Fibroblast growth factor homologous factor 2 (FHF2): gene structure, expression and mapping to the Borjeson-Forssman-Lehmann syndrome region in Xq26 delineated by a duplication breakpoint in a BFLS-like patient."
    Gecz J., Baker E., Donnelly A., Ming J.E., McDonnald-McGinn D.M., Spinner N.B., Zackai E.H., Sutherland G.R., Mulley J.C.
    Hum. Genet. 104:56-63(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Kidney.
  4. NIEHS SNPs program
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLN-197.
  5. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung and Skin.
  8. "Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing."
    Munoz-Sanjuan I., Smallwood P.M., Nathans J.
    J. Biol. Chem. 275:2589-2597(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
  9. "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart."
    Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M.
    Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  10. "Fibroblast growth factor homologous factors are intracellular signaling proteins."
    Schoorlemmer J., Goldfarb M.
    Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAPK8IP2.
  11. "Fibroblast growth factor homologous factor 2B: association with Nav1.6 and selective colocalization at nodes of Ranvier of dorsal root axons."
    Wittmack E.K., Rush A.M., Craner M.J., Goldfarb M., Waxman S.G., Dib-Hajj S.D.
    J. Neurosci. 24:6765-6775(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN SCN8A REGULATION, INTERACTION WITH SCN8A.
  12. "Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts."
    Wang C., Hennessey J.A., Kirkton R.D., Wang C., Graham V., Puranam R.S., Rosenberg P.B., Bursac N., Pitt G.S.
    Circ. Res. 109:775-782(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SCN5A.
  13. "Identification of novel interaction sites that determine specificity between fibroblast growth factor homologous factors and voltage-gated sodium channels."
    Wang C., Wang C., Hoch E.G., Pitt G.S.
    J. Biol. Chem. 286:24253-24263(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SCN1A; SCN2A; SCN5A AND SCN8A, MUTAGENESIS OF PRO-207.
  14. "Crystal structure of a fibroblast growth factor homologous factor (FHF) defines a conserved surface on FHFs for binding and modulation of voltage-gated sodium channels."
    Goetz R., Dover K., Laezza F., Shtraizent N., Huang X., Tchetchik D., Eliseenkova A.V., Xu C.F., Neubert T.A., Ornitz D.M., Goldfarb M., Mohammadi M.
    J. Biol. Chem. 284:17883-17896(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 53-245, INTERACTION WITH SCN1A; SCN11A; SCN2A AND SCN5A.

Entry informationi

Entry nameiFGF13_HUMAN
AccessioniPrimary (citable) accession number: Q92913
Secondary accession number(s): B1AK18
, B7Z4M7, B7Z8N0, D3DWH4, O95830, Q9NZH9, Q9NZI0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: October 29, 2014
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3