Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 13

Gene

FGF13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.1 Publication
May regulate voltage-gated sodium channels transport and function.1 Publication
May also play a role in MAPK signaling.1 Publication

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • growth factor activity Source: ProtInc
  • ion channel binding Source: UniProtKB
  • microtubule binding Source: UniProtKB
  • protein kinase activator activity Source: MGI
  • sodium channel regulator activity Source: UniProtKB

GO - Biological processi

  • cell-cell signaling Source: ProtInc
  • cerebral cortex cell migration Source: UniProtKB
  • establishment of neuroblast polarity Source: UniProtKB
  • hippocampus development Source: UniProtKB
  • learning Source: UniProtKB
  • MAPK cascade Source: MGI
  • memory Source: UniProtKB
  • microtubule polymerization Source: UniProtKB
  • negative regulation of collateral sprouting Source: UniProtKB
  • negative regulation of microtubule depolymerization Source: UniProtKB
  • nervous system development Source: ProtInc
  • neuron migration Source: UniProtKB
  • protein localization to plasma membrane Source: UniProtKB
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Neurogenesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000129682-MONOMER.
ReactomeiR-HSA-5576892. Phase 0 - rapid depolarisation.
SIGNORiQ92913.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 13
Short name:
FGF-13
Alternative name(s):
Fibroblast growth factor homologous factor 2
Short name:
FHF-2
Gene namesi
Name:FGF13
Synonyms:FHF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:3670. FGF13.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Microtubule, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi207P → Q: Loss of interaction with SCN1A. 1 Publication1

Organism-specific databases

DisGeNETi2258.
OpenTargetsiENSG00000129682.
ENSG00000283147.
PharmGKBiPA28109.

Polymorphism and mutation databases

BioMutaiFGF13.
DMDMi2494461.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001476071 – 245Fibroblast growth factor 13Add BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei208PhosphoserineCombined sources1

Post-translational modificationi

May be phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ92913.
PeptideAtlasiQ92913.
PRIDEiQ92913.

PTM databases

iPTMnetiQ92913.
PhosphoSitePlusiQ92913.

Expressioni

Tissue specificityi

Ubiquitously expressed. Predominantly expressed in the nervous system.1 Publication

Gene expression databases

BgeeiENSG00000129682.
CleanExiHS_FGF13.
ExpressionAtlasiQ92913. baseline and differential.
GenevisibleiQ92913. HS.

Organism-specific databases

HPAiHPA002809.

Interactioni

Subunit structurei

Interacts with SCN8A; may regulate SCN8A activity. Interacts with SCN1A; may regulate SCN1A activity. Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. May also interact with SCN2A and SCN11A. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.5 Publications

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • growth factor activity Source: ProtInc
  • ion channel binding Source: UniProtKB
  • microtubule binding Source: UniProtKB

Protein-protein interaction databases

BioGridi108549. 4 interactors.
DIPiDIP-50447N.
IntActiQ92913. 2 interactors.
STRINGi9606.ENSP00000359635.

Structurei

Secondary structure

1245
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi66 – 75Combined sources10
Turni76 – 78Combined sources3
Beta strandi80 – 83Combined sources4
Beta strandi89 – 93Combined sources5
Helixi98 – 100Combined sources3
Beta strandi102 – 108Combined sources7
Beta strandi111 – 116Combined sources6
Turni117 – 119Combined sources3
Beta strandi122 – 125Combined sources4
Beta strandi131 – 137Combined sources7
Helixi139 – 141Combined sources3
Beta strandi142 – 148Combined sources7
Turni149 – 151Combined sources3
Beta strandi152 – 161Combined sources10
Turni163 – 165Combined sources3
Beta strandi168 – 170Combined sources3
Beta strandi177 – 179Combined sources3
Helixi182 – 184Combined sources3
Helixi190 – 192Combined sources3
Beta strandi194 – 204Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HBWX-ray1.90A/B53-245[»]
4DCKX-ray2.20C63-245[»]
4JPZX-ray3.02A/E60-245[»]
ProteinModelPortaliQ92913.
SMRiQ92913.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92913.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 62Mediates targeting to the nucleusBy similarityAdd BLAST62
Regioni67 – 201Mediates interaction with sodium channelsAdd BLAST135

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3885. Eukaryota.
ENOG4111IPH. LUCA.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiQ92913.
KOiK04358.
OMAiKSNACRC.
OrthoDBiEOG091G0NAY.
PhylomeDBiQ92913.
TreeFamiTF317805.

Family and domain databases

CDDicd00058. FGF. 1 hit.
InterProiIPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PfamiPF00167. FGF. 1 hit.
[Graphical view]
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92913-1) [UniParc]FASTAAdd to basket
Also known as: FGF13A, 1A, hFHF-2(1S), FGF13S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK
60 70 80 90 100
LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT
110 120 130 140 150
LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSELFTPE CKFKESVFEN
160 170 180 190 200
YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK
210 220 230 240
VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST
Length:245
Mass (Da):27,564
Last modified:February 1, 1997 - v1
Checksum:i30FB62C6B2669F29
GO
Isoform 2 (identifier: Q92913-2) [UniParc]FASTAAdd to basket
Also known as: FGF13B, 1B, hFHF-2(1U), FGF13U

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

Show »
Length:192
Mass (Da):21,581
Checksum:i1C5B15BB67B2F232
GO
Isoform 3 (identifier: Q92913-3) [UniParc]FASTAAdd to basket
Also known as: hFHF-2(1Y+1V), FGF13YV

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKE...VHHKENTEPE

Show »
Length:255
Mass (Da):28,752
Checksum:iADAB4C72927597DC
GO
Isoform 4 (identifier: Q92913-4) [UniParc]FASTAAdd to basket
Also known as: hFHF-2(1Z+1Y), FGF13V

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MSGKVTKPKEEKDASK

Show »
Length:199
Mass (Da):22,275
Checksum:iD73D2E43AAA1414F
GO
Isoform 5 (identifier: Q92913-5) [UniParc]FASTAAdd to basket
Also known as: hFHF-2(1X+1W+1V), FGF13Y

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLI...GSKKRRRRRP → MLRQDSIQSA...VHHKENTEPE

Show »
Length:226
Mass (Da):25,607
Checksum:i59444607415A4FD0
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020945197K → Q.1 PublicationCorresponds to variant rs17510270dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0015291 – 62MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0434611 – 62MAAAI…RRRRP → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPL KQVHHKENTEPE in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0434601 – 62MAAAI…RRRRP → MSGKVTKPKEEKDASK in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0441291 – 62MAAAI…RRRRP → MLRQDSIQSAELKKKESPFR AKCHEIFCCPLKQVHHKENT EPE in isoform 5. CuratedAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66198 mRNA. Translation: AAB18914.1.
AF100143 mRNA. Translation: AAD16400.1.
AF100144 mRNA. Translation: AAD16401.1.
AK297545 mRNA. Translation: BAH12613.1.
AK303685 mRNA. Translation: BAH14016.1.
AK316170 mRNA. Translation: BAH14541.1.
AY672645 Genomic DNA. Translation: AAT70720.1.
AL031386, Z82193 Genomic DNA. Translation: CAI95616.1.
Z82193, AL031386 Genomic DNA. Translation: CAI95677.1.
Z81007 Genomic DNA. No translation available.
Z82204 Genomic DNA. Translation: CAI42696.1.
Z83313 Genomic DNA. No translation available.
AL023798 Genomic DNA. No translation available.
AL023800 Genomic DNA. No translation available.
AL034398 Genomic DNA. No translation available.
AL034416 Genomic DNA. No translation available.
CH471150 Genomic DNA. Translation: EAW88435.1.
CH471150 Genomic DNA. Translation: EAW88438.1.
CH471150 Genomic DNA. Translation: EAW88440.1.
BC012347 mRNA. Translation: AAH12347.1.
BC034340 mRNA. Translation: AAH34340.1.
AF199612 mRNA. Translation: AAF31399.1.
AF199613 mRNA. Translation: AAF31400.1.
CCDSiCCDS14664.1. [Q92913-2]
CCDS14665.1. [Q92913-1]
CCDS55511.1. [Q92913-5]
CCDS55512.1. [Q92913-4]
CCDS55513.1. [Q92913-3]
RefSeqiNP_001132970.1. NM_001139498.1. [Q92913-4]
NP_001132972.1. NM_001139500.1. [Q92913-3]
NP_001132973.1. NM_001139501.1. [Q92913-5]
NP_001132974.1. NM_001139502.1. [Q92913-5]
NP_004105.1. NM_004114.3. [Q92913-1]
NP_378668.1. NM_033642.2. [Q92913-2]
XP_005262456.1. XM_005262399.1. [Q92913-3]
UniGeneiHs.6540.

Genome annotation databases

EnsembliENST00000305414; ENSP00000303391; ENSG00000129682. [Q92913-2]
ENST00000315930; ENSP00000322390; ENSG00000129682. [Q92913-1]
ENST00000436198; ENSP00000396198; ENSG00000129682. [Q92913-3]
ENST00000626909; ENSP00000487411; ENSG00000129682. [Q92913-4]
GeneIDi2258.
KEGGihsa:2258.
UCSCiuc004fal.4. human. [Q92913-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66198 mRNA. Translation: AAB18914.1.
AF100143 mRNA. Translation: AAD16400.1.
AF100144 mRNA. Translation: AAD16401.1.
AK297545 mRNA. Translation: BAH12613.1.
AK303685 mRNA. Translation: BAH14016.1.
AK316170 mRNA. Translation: BAH14541.1.
AY672645 Genomic DNA. Translation: AAT70720.1.
AL031386, Z82193 Genomic DNA. Translation: CAI95616.1.
Z82193, AL031386 Genomic DNA. Translation: CAI95677.1.
Z81007 Genomic DNA. No translation available.
Z82204 Genomic DNA. Translation: CAI42696.1.
Z83313 Genomic DNA. No translation available.
AL023798 Genomic DNA. No translation available.
AL023800 Genomic DNA. No translation available.
AL034398 Genomic DNA. No translation available.
AL034416 Genomic DNA. No translation available.
CH471150 Genomic DNA. Translation: EAW88435.1.
CH471150 Genomic DNA. Translation: EAW88438.1.
CH471150 Genomic DNA. Translation: EAW88440.1.
BC012347 mRNA. Translation: AAH12347.1.
BC034340 mRNA. Translation: AAH34340.1.
AF199612 mRNA. Translation: AAF31399.1.
AF199613 mRNA. Translation: AAF31400.1.
CCDSiCCDS14664.1. [Q92913-2]
CCDS14665.1. [Q92913-1]
CCDS55511.1. [Q92913-5]
CCDS55512.1. [Q92913-4]
CCDS55513.1. [Q92913-3]
RefSeqiNP_001132970.1. NM_001139498.1. [Q92913-4]
NP_001132972.1. NM_001139500.1. [Q92913-3]
NP_001132973.1. NM_001139501.1. [Q92913-5]
NP_001132974.1. NM_001139502.1. [Q92913-5]
NP_004105.1. NM_004114.3. [Q92913-1]
NP_378668.1. NM_033642.2. [Q92913-2]
XP_005262456.1. XM_005262399.1. [Q92913-3]
UniGeneiHs.6540.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HBWX-ray1.90A/B53-245[»]
4DCKX-ray2.20C63-245[»]
4JPZX-ray3.02A/E60-245[»]
ProteinModelPortaliQ92913.
SMRiQ92913.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108549. 4 interactors.
DIPiDIP-50447N.
IntActiQ92913. 2 interactors.
STRINGi9606.ENSP00000359635.

PTM databases

iPTMnetiQ92913.
PhosphoSitePlusiQ92913.

Polymorphism and mutation databases

BioMutaiFGF13.
DMDMi2494461.

Proteomic databases

PaxDbiQ92913.
PeptideAtlasiQ92913.
PRIDEiQ92913.

Protocols and materials databases

DNASUi2258.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305414; ENSP00000303391; ENSG00000129682. [Q92913-2]
ENST00000315930; ENSP00000322390; ENSG00000129682. [Q92913-1]
ENST00000436198; ENSP00000396198; ENSG00000129682. [Q92913-3]
ENST00000626909; ENSP00000487411; ENSG00000129682. [Q92913-4]
GeneIDi2258.
KEGGihsa:2258.
UCSCiuc004fal.4. human. [Q92913-1]

Organism-specific databases

CTDi2258.
DisGeNETi2258.
GeneCardsiFGF13.
HGNCiHGNC:3670. FGF13.
HPAiHPA002809.
MIMi300070. gene.
neXtProtiNX_Q92913.
OpenTargetsiENSG00000129682.
ENSG00000283147.
PharmGKBiPA28109.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3885. Eukaryota.
ENOG4111IPH. LUCA.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiQ92913.
KOiK04358.
OMAiKSNACRC.
OrthoDBiEOG091G0NAY.
PhylomeDBiQ92913.
TreeFamiTF317805.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000129682-MONOMER.
ReactomeiR-HSA-5576892. Phase 0 - rapid depolarisation.
SIGNORiQ92913.

Miscellaneous databases

ChiTaRSiFGF13. human.
EvolutionaryTraceiQ92913.
GeneWikiiFGF13.
GenomeRNAii2258.
PROiQ92913.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129682.
CleanExiHS_FGF13.
ExpressionAtlasiQ92913. baseline and differential.
GenevisibleiQ92913. HS.

Family and domain databases

CDDicd00058. FGF. 1 hit.
InterProiIPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PfamiPF00167. FGF. 1 hit.
[Graphical view]
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFGF13_HUMAN
AccessioniPrimary (citable) accession number: Q92913
Secondary accession number(s): B1AK18
, B7Z4M7, B7Z8N0, D3DWH4, O95830, Q9NZH9, Q9NZI0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.