Reviewed,
UniProtKB/Swiss-Prot Q92890 (UFD1_HUMAN)
Last modified
March 2, 2010.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ubiquitin fusion degradation protein 1 homolog Short name=UB fusion protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 307 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures. |
| Pathway | Protein degradation; proteasomal ubiquitin-dependent pathway. |
| Subunit structure | Heterodimer with NPLOC4, this heterodimer binds VCP and inhibits Golgi membrane fusion. |
| Subcellular location | |
| Tissue specificity | Found in adult heart, skeletal muscle and pancreas, and in fetal liver and kidney. |
| Sequence similarities | Belongs to the UFD1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | skeletal system development Traceable author statement. Source: ProtInc ubiquitin-dependent protein catabolic process Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: UniProtKB ubiquitin-specific protease activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Short (identifier: Q92890-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform Long (identifier: Q92890-1) The sequence of this isoform differs from the canonical sequence as follows: 106-106: E → EDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 307 | 307 | Ubiquitin fusion degradation protein 1 homolog | PRO_0000194984 | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 245 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 247 | 1 | Phosphoserine Ref.9 Ref.6 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 299 | 1 | Phosphoserine Ref.9 Ref.7 Ref.8 Ref.12 | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 106 | 1 | E → EDGLVQLETVNLQVATYSKS KFCYLPHWMMQNLLLEE in isoform Long. | VSP_006707 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 130 | 1 | P → A: dbSNP rs17744624. Ref.1 | VAR_052436 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 33 | 1 | G → W in AAD08720. Ref.1 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 183 | 1 | I → H in AAD08720. Ref.1 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 16 – 18 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 20 – 26 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 35 | 5 | |||||||||||||||||||||||||||||||||||||||
| Turn | 39 – 44 | 6 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 45 – 47 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 58 | 9 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 71 | 6 | |||||||||||||||||||||||||||||||||||||||
| Turn | 72 – 75 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 76 – 84 | 9 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 93 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 97 – 102 | 6 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 108 – 115 | 8 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 121 – 129 | 9 | |||||||||||||||||||||||||||||||||||||||
| Helix | 130 – 134 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 138 – 146 | 9 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 157 – 164 | 8 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 181 | 16 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 191 | 4 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "UFD1L, a developmentally expressed ubiquitination gene, is deleted in CATCH 22 syndrome." Pizzuti A., Novelli G., Ratti A., Amati F., Mari A., Calabrese G., Nicolis S., Silani V., Marino B., Scarlato G., Ottolenghi S., Dallapiccola B. Hum. Mol. Genet. 6:259-265(1997) [PubMed: 9063746] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), VARIANT ALA-130. Tissue: Brain. |
| [2] | "Characterization of human UFD1, a ubiquitin fusion-degradation protein." Gong L., Yeh E.T.H. Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Heart. |
| [3] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Brain and Skin. |
| [5] | "Cloning and characterization of the gene encoding human NPL4, a protein interacting with the ubiquitin fusion-degradation protein (UFD1L)." Botta A., Tandoi C., Fini G., Calabrese G., Dallapiccola B., Novelli G. Gene 275:39-46(2001) [PubMed: 11574150] [Abstract] Cited for: INTERACTION WITH NPLOC4. |
| [6] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-247, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, MASS SPECTROMETRY. |
| [8] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed: 19367720] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, MASS SPECTROMETRY. Tissue: T-cell. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245; SER-247 AND SER-299, MASS SPECTROMETRY. |
| [10] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [11] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, MASS SPECTROMETRY. Tissue: T-cell. |
| [13] | "Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 11-193. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U64444 mRNA. Translation: AAD08720.1. AF141201 mRNA. Translation: AAD28788.1. CR456607 mRNA. Translation: CAG30493.1. BC001049 mRNA. Translation: AAH01049.1. BC005087 mRNA. Translation: AAH05087.1. | ||||||||||||
| IPI | IPI00218292. IPI00655754. | ||||||||||||
| RefSeq | NP_005650.2. | ||||||||||||
| UniGene | Hs.474213 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q92890. 14 interactions. | ||||||||||||
| STRING | Q92890. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q92890. | ||||||||||||
2-D gel databases | |||||||||||||
| OGP | Q92890. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q92890. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000263202; ENSP00000263202; ENSG00000070010; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 7353. | ||||||||||||
| UCSC | uc002zpm.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 7353. | ||||||||||||
| GeneCards | GC22M017812. | ||||||||||||
| H-InvDB | HIX0016237. | ||||||||||||
| HGNC | HGNC:12520. UFD1L. | ||||||||||||
| MIM | 601754. gene. | ||||||||||||
| Orphanet | 567. Monosomy 22q11. | ||||||||||||
| PharmGKB | PA37167. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | HBG001266. | ||||||||||||
| OrthoDB | EOG9B5RQW. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q92890. | ||||||||||||
| Bgee | Q92890. | ||||||||||||
| CleanEx | HS_UFD1L. | ||||||||||||
| Genevestigator | Q92890. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR004854. UFD1. [Graphical view] | ||||||||||||
| Pfam | PF03152. UFD1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 28788. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UFD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92890 Secondary accession number(s): Q9Y5N0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


