Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin fusion degradation protein 1 homolog

Gene

UFD1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures.

Pathwayi: proteasomal ubiquitin-dependent pathway

This protein is involved in the pathway proteasomal ubiquitin-dependent pathway, which is part of Protein degradation.
View all proteins of this organism that are known to be involved in the pathway proteasomal ubiquitin-dependent pathway and in Protein degradation.

GO - Molecular functioni

  • thiol-dependent ubiquitin-specific protease activity Source: ProtInc

GO - Biological processi

  • ER-associated misfolded protein catabolic process Source: ParkinsonsUK-UCL
  • error-free translesion synthesis Source: Reactome
  • retrograde protein transport, ER to cytosol Source: ParkinsonsUK-UCL
  • skeletal system development Source: ProtInc
  • ubiquitin-dependent protein catabolic process Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-110320. Translesion Synthesis by POLH.
UniPathwayiUPA00144.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin fusion degradation protein 1 homolog
Short name:
UB fusion protein 1
Gene namesi
Name:UFD1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:12520. UFD1L.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB-SubCell
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
  • UFD1-NPL4 complex Source: ParkinsonsUK-UCL
  • VCP-NPL4-UFD1 AAA ATPase complex Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

MalaCardsiUFD1L.
Orphaneti567. 22q11.2 deletion syndrome.
PharmGKBiPA37167.

Polymorphism and mutation databases

BioMutaiUFD1L.
DMDMi160332310.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 307307Ubiquitin fusion degradation protein 1 homologPRO_0000194984Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei231 – 2311PhosphoserineCombined sources
Modified residuei245 – 2451PhosphoserineCombined sources
Modified residuei247 – 2471PhosphoserineCombined sources
Modified residuei299 – 2991PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ92890.
MaxQBiQ92890.
PaxDbiQ92890.
PRIDEiQ92890.

2D gel databases

OGPiQ92890.

PTM databases

iPTMnetiQ92890.
PhosphoSiteiQ92890.

Expressioni

Tissue specificityi

Found in adult heart, skeletal muscle and pancreas, and in fetal liver and kidney.

Gene expression databases

BgeeiQ92890.
CleanExiHS_UFD1L.
ExpressionAtlasiQ92890. baseline and differential.
GenevisibleiQ92890. HS.

Organism-specific databases

HPAiHPA030287.
HPA055579.

Interactioni

Subunit structurei

Heterodimer with NPLOC4, this heterodimer binds VCP and inhibits Golgi membrane fusion. Interacts with USP13.2 Publications

Protein-protein interaction databases

BioGridi113200. 89 interactions.
DIPiDIP-45954N.
IntActiQ92890. 30 interactions.
MINTiMINT-2837704.
STRINGi9606.ENSP00000263202.

Structurei

Secondary structure

1
307
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi16 – 183Combined sources
Beta strandi20 – 267Combined sources
Beta strandi31 – 355Combined sources
Turni39 – 446Combined sources
Beta strandi45 – 473Combined sources
Helixi50 – 589Combined sources
Beta strandi66 – 716Combined sources
Turni72 – 754Combined sources
Beta strandi76 – 849Combined sources
Beta strandi91 – 933Combined sources
Helixi97 – 1026Combined sources
Beta strandi108 – 1158Combined sources
Beta strandi121 – 1299Combined sources
Helixi130 – 1345Combined sources
Helixi138 – 1469Combined sources
Beta strandi157 – 1648Combined sources
Beta strandi166 – 18116Combined sources
Beta strandi188 – 1914Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUJNMR-A11-193[»]
5C1BX-ray3.08U/V221-241[»]
ProteinModelPortaliQ92890.
SMRiQ92890. Positions 11-193.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92890.

Family & Domainsi

Sequence similaritiesi

Belongs to the UFD1 family.Curated

Phylogenomic databases

eggNOGiKOG1816. Eukaryota.
COG5140. LUCA.
GeneTreeiENSGT00390000002408.
HOGENOMiHOG000212737.
HOVERGENiHBG001266.
InParanoidiQ92890.
KOiK14016.
OMAiADHSSYA.
OrthoDBiEOG70ZZNS.
PhylomeDBiQ92890.
TreeFamiTF314581.

Family and domain databases

InterProiIPR004854. UFD1.
[Graphical view]
PANTHERiPTHR12555. PTHR12555. 1 hit.
PfamiPF03152. UFD1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Short (identifier: Q92890-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSFNMFDHP IPRVFQNRFS TQYRCFSVSM LAGPNDRSDV EKGGKIIMPP
60 70 80 90 100
SALDQLSRLN ITYPMLFKLT NKNSDRMTHC GVLEFVADEG ICYLPHWMMQ
110 120 130 140 150
NLLLEEGGLV QVESVNLQVA TYSKFQPQSP DFLDITNPKA VLENALRNFA
160 170 180 190 200
CLTTGDVIAI NYNEKIYELR VMETKPDKAV SIIECDMNVD FDAPLGYKEP
210 220 230 240 250
ERQVQHEEST EGEADHSGYA GELGFRAFSG SGNRLDGKKK GVEPSPSPIK
260 270 280 290 300
PGDIKRGIPN YEFKLGKITF IRNSRPLVKK VEEDEAGGRF VAFSGEGQSL

RKKGRKP
Note: Major isoform.
Length:307
Mass (Da):34,500
Last modified:November 13, 2007 - v3
Checksum:iFC69860002C042C6
GO
Isoform Long (identifier: Q92890-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: E → EDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEE

Show »
Length:343
Mass (Da):38,725
Checksum:i94D55B70E7F5A27F
GO
Isoform 3 (identifier: Q92890-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-307: Missing.

Note: No experimental confirmation available.
Show »
Length:266
Mass (Da):29,901
Checksum:i8CE8E9AE3BF71ED6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251C → R in AK225877 (Ref. 4) Curated
Sequence conflicti33 – 331G → W in AAD08720 (PubMed:9063746).Curated
Sequence conflicti183 – 1831I → H in AAD08720 (PubMed:9063746).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti130 – 1301P → A.1 Publication
Corresponds to variant rs17744624 [ dbSNP | Ensembl ].
VAR_052436

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei106 – 1061E → EDGLVQLETVNLQVATYSKS KFCYLPHWMMQNLLLEE in isoform Long. 1 PublicationVSP_006707
Alternative sequencei267 – 30741Missing in isoform 3. 1 PublicationVSP_045044Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64444 mRNA. Translation: AAD08720.1.
AF141201 mRNA. Translation: AAD28788.1.
CR456607 mRNA. Translation: CAG30493.1.
AK225877 mRNA. No translation available.
AC000068 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
BC001049 mRNA. Translation: AAH01049.1.
BC005087 mRNA. Translation: AAH05087.1.
CCDSiCCDS13761.1. [Q92890-2]
CCDS33600.2. [Q92890-3]
RefSeqiNP_001030324.2. NM_001035247.2. [Q92890-3]
NP_005650.2. NM_005659.6. [Q92890-2]
UniGeneiHs.474213.

Genome annotation databases

EnsembliENST00000263202; ENSP00000263202; ENSG00000070010. [Q92890-2]
ENST00000399523; ENSP00000382439; ENSG00000070010. [Q92890-3]
GeneIDi7353.
KEGGihsa:7353.
UCSCiuc002zpm.3. human. [Q92890-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64444 mRNA. Translation: AAD08720.1.
AF141201 mRNA. Translation: AAD28788.1.
CR456607 mRNA. Translation: CAG30493.1.
AK225877 mRNA. No translation available.
AC000068 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
BC001049 mRNA. Translation: AAH01049.1.
BC005087 mRNA. Translation: AAH05087.1.
CCDSiCCDS13761.1. [Q92890-2]
CCDS33600.2. [Q92890-3]
RefSeqiNP_001030324.2. NM_001035247.2. [Q92890-3]
NP_005650.2. NM_005659.6. [Q92890-2]
UniGeneiHs.474213.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUJNMR-A11-193[»]
5C1BX-ray3.08U/V221-241[»]
ProteinModelPortaliQ92890.
SMRiQ92890. Positions 11-193.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113200. 89 interactions.
DIPiDIP-45954N.
IntActiQ92890. 30 interactions.
MINTiMINT-2837704.
STRINGi9606.ENSP00000263202.

PTM databases

iPTMnetiQ92890.
PhosphoSiteiQ92890.

Polymorphism and mutation databases

BioMutaiUFD1L.
DMDMi160332310.

2D gel databases

OGPiQ92890.

Proteomic databases

EPDiQ92890.
MaxQBiQ92890.
PaxDbiQ92890.
PRIDEiQ92890.

Protocols and materials databases

DNASUi7353.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263202; ENSP00000263202; ENSG00000070010. [Q92890-2]
ENST00000399523; ENSP00000382439; ENSG00000070010. [Q92890-3]
GeneIDi7353.
KEGGihsa:7353.
UCSCiuc002zpm.3. human. [Q92890-2]

Organism-specific databases

CTDi7353.
GeneCardsiUFD1L.
HGNCiHGNC:12520. UFD1L.
HPAiHPA030287.
HPA055579.
MalaCardsiUFD1L.
MIMi601754. gene.
neXtProtiNX_Q92890.
Orphaneti567. 22q11.2 deletion syndrome.
PharmGKBiPA37167.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1816. Eukaryota.
COG5140. LUCA.
GeneTreeiENSGT00390000002408.
HOGENOMiHOG000212737.
HOVERGENiHBG001266.
InParanoidiQ92890.
KOiK14016.
OMAiADHSSYA.
OrthoDBiEOG70ZZNS.
PhylomeDBiQ92890.
TreeFamiTF314581.

Enzyme and pathway databases

UniPathwayiUPA00144.
ReactomeiR-HSA-110320. Translesion Synthesis by POLH.

Miscellaneous databases

ChiTaRSiUFD1L. human.
EvolutionaryTraceiQ92890.
GeneWikiiUFD1L.
GenomeRNAii7353.
PROiQ92890.
SOURCEiSearch...

Gene expression databases

BgeeiQ92890.
CleanExiHS_UFD1L.
ExpressionAtlasiQ92890. baseline and differential.
GenevisibleiQ92890. HS.

Family and domain databases

InterProiIPR004854. UFD1.
[Graphical view]
PANTHERiPTHR12555. PTHR12555. 1 hit.
PfamiPF03152. UFD1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "UFD1L, a developmentally expressed ubiquitination gene, is deleted in CATCH 22 syndrome."
    Pizzuti A., Novelli G., Ratti A., Amati F., Mari A., Calabrese G., Nicolis S., Silani V., Marino B., Scarlato G., Ottolenghi S., Dallapiccola B.
    Hum. Mol. Genet. 6:259-265(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), VARIANT ALA-130.
    Tissue: Brain.
  2. "Characterization of human UFD1, a ubiquitin fusion-degradation protein."
    Gong L., Yeh E.T.H.
    Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Tissue: Heart.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  5. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
    Tissue: Brain and Skin.
  7. "Cloning and characterization of the gene encoding human NPL4, a protein interacting with the ubiquitin fusion-degradation protein (UFD1L)."
    Botta A., Tandoi C., Fini G., Calabrese G., Dallapiccola B., Novelli G.
    Gene 275:39-46(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NPLOC4.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-231; SER-245; SER-247 AND SER-299, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control."
    Chen M., Gutierrez G.J., Ronai Z.A.
    Proc. Natl. Acad. Sci. U.S.A. 108:9119-9124(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH USP13.
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 11-193.

Entry informationi

Entry nameiUFD1_HUMAN
AccessioniPrimary (citable) accession number: Q92890
Secondary accession number(s): A8MW31, Q9Y5N0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 13, 2007
Last modified: June 8, 2016
This is version 137 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.