Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92859

- NEO1_HUMAN

UniProt

Q92859 - NEO1_HUMAN

Protein

Neogenin

Gene

NEO1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 152 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response.1 Publication

    GO - Molecular functioni

    1. receptor activity Source: Ensembl

    GO - Biological processi

    1. axon guidance Source: Reactome
    2. cell adhesion Source: ProtInc
    3. iron ion homeostasis Source: MGI
    4. muscle cell differentiation Source: Reactome
    5. myoblast fusion Source: Ensembl
    6. positive regulation of muscle cell differentiation Source: Reactome
    7. regulation of transcription, DNA-templated Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_21402. CDO in myogenesis.
    REACT_22237. Netrin-1 signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neogenin
    Alternative name(s):
    Immunoglobulin superfamily DCC subclass member 2
    Gene namesi
    Name:NEO1
    Synonyms:IGDCC2, NGN
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:7754. NEO1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31555.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3333Sequence AnalysisAdd
    BLAST
    Chaini34 – 14611428NeogeninPRO_0000015043Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi73 – 731N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi74 ↔ 129PROSITE-ProRule annotation
    Disulfide bondi173 ↔ 221PROSITE-ProRule annotation
    Glycosylationi210 – 2101N-linked (GlcNAc...)2 Publications
    Disulfide bondi270 ↔ 320PROSITE-ProRule annotation
    Glycosylationi326 – 3261N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi362 ↔ 410PROSITE-ProRule annotation
    Glycosylationi470 – 4701N-linked (GlcNAc...)1 Publication
    Glycosylationi489 – 4891N-linked (GlcNAc...)1 Publication
    Glycosylationi639 – 6391N-linked (GlcNAc...)1 Publication
    Glycosylationi715 – 7151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi909 – 9091N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ92859.
    PaxDbiQ92859.
    PRIDEiQ92859.

    PTM databases

    PhosphoSiteiQ92859.

    Expressioni

    Tissue specificityi

    Widely expressed and also in cancer cell lines.

    Gene expression databases

    ArrayExpressiQ92859.
    BgeeiQ92859.
    CleanExiHS_NEO1.
    GenevestigatoriQ92859.

    Organism-specific databases

    HPAiCAB009320.
    HPA027804.
    HPA027805.
    HPA027806.

    Interactioni

    Subunit structurei

    Interacts with MYO10 By similarity. Interacts with RGMA and RGMB. Interacts with BMP2, BMP4, BMP6, and BMP7.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi110830. 7 interactions.
    DIPiDIP-46272N.
    IntActiQ92859. 2 interactions.
    STRINGi9606.ENSP00000261908.

    Structurei

    Secondary structure

    1
    1461
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi443 – 4508
    Beta strandi455 – 4606
    Beta strandi470 – 47910
    Beta strandi486 – 4894
    Beta strandi496 – 5005
    Beta strandi508 – 5169
    Beta strandi521 – 5244
    Beta strandi528 – 5314
    Beta strandi546 – 5516
    Beta strandi554 – 5585
    Beta strandi570 – 5789
    Beta strandi587 – 5893
    Beta strandi591 – 5966
    Beta strandi604 – 6129
    Beta strandi638 – 6436
    Beta strandi646 – 65510
    Turni659 – 6613
    Beta strandi666 – 6705
    Beta strandi672 – 6754
    Beta strandi678 – 6836
    Beta strandi693 – 6975
    Beta strandi704 – 7085
    Beta strandi710 – 7134
    Beta strandi716 – 7205
    Beta strandi724 – 7274
    Beta strandi743 – 7508
    Beta strandi753 – 7597
    Beta strandi770 – 7756
    Helixi780 – 7823
    Beta strandi783 – 7864
    Beta strandi793 – 7964
    Beta strandi808 – 8125
    Beta strandi858 – 8647
    Beta strandi866 – 8683
    Beta strandi870 – 8756
    Beta strandi881 – 8833
    Beta strandi890 – 8978
    Beta strandi906 – 91712
    Beta strandi925 – 93410
    Beta strandi945 – 9484
    Beta strandi959 – 9668
    Beta strandi969 – 97810
    Beta strandi989 – 9968
    Beta strandi998 – 10003
    Helixi1002 – 10043
    Beta strandi1005 – 10139
    Beta strandi1015 – 10195
    Beta strandi1027 – 103610
    Beta strandi1047 – 10504

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1X5FNMR-A429-535[»]
    1X5GNMR-A529-631[»]
    1X5HNMR-A623-741[»]
    1X5INMR-A719-831[»]
    1X5JNMR-A853-952[»]
    1X5KNMR-A944-1054[»]
    3P4LX-ray1.80A853-1054[»]
    ProteinModelPortaliQ92859.
    SMRiQ92859. Positions 53-1057.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ92859.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini34 – 11051072ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1127 – 1461335CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1106 – 112621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini52 – 14190Ig-like C2-type 1Add
    BLAST
    Domaini152 – 23887Ig-like C2-type 2Add
    BLAST
    Domaini243 – 33694Ig-like C2-type 3Add
    BLAST
    Domaini341 – 42686Ig-like C2-type 4Add
    BLAST
    Domaini441 – 53595Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini541 – 63191Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini636 – 73196Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini741 – 83191Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini856 – 95297Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini957 – 105498Fibronectin type-III 6PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1118 – 11214Poly-Val

    Domaini

    The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.By similarity

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. DCC family.Curated
    Contains 6 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG249790.
    HOGENOMiHOG000230686.
    HOVERGENiHBG005455.
    InParanoidiQ92859.
    KOiK06766.
    OMAiVRWKTNI.
    OrthoDBiEOG7RRF65.
    PhylomeDBiQ92859.
    TreeFamiTF321506.

    Family and domain databases

    Gene3Di2.60.40.10. 10 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR010560. Neogenin_C.
    [Graphical view]
    PfamiPF00041. fn3. 6 hits.
    PF07679. I-set. 3 hits.
    PF06583. Neogenin_C. 1 hit.
    [Graphical view]
    SMARTiSM00060. FN3. 6 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 3 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 4 hits.
    PROSITEiPS50853. FN3. 6 hits.
    PS50835. IG_LIKE. 4 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q92859-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAERGARRL LSTPSFWLYC LLLLGRRAPG AAAARSGSAP QSPGASIRTF     50
    TPFYFLVEPV DTLSVRGSSV ILNCSAYSEP SPKIEWKKDG TFLNLVSDDR 100
    RQLLPDGSLF ISNVVHSKHN KPDEGYYQCV ATVESLGTII SRTAKLIVAG 150
    LPRFTSQPEP SSVYAGNNAI LNCEVNADLV PFVRWEQNRQ PLLLDDRVIK 200
    LPSGMLVISN ATEGDGGLYR CVVESGGPPK YSDEVELKVL PDPEVISDLV 250
    FLKQPSPLVR VIGQDVVLPC VASGLPTPTI KWMKNEEALD TESSERLVLL 300
    AGGSLEISDV TEDDAGTYFC IADNGNETIE AQAELTVQAQ PEFLKQPTNI 350
    YAHESMDIVF ECEVTGKPTP TVKWVKNGDM VIPSDYFKIV KEHNLQVLGL 400
    VKSDEGFYQC IAENDVGNAQ AGAQLIILEH APATTGPLPS APRDVVASLV 450
    STRFIKLTWR TPASDPHGDN LTYSVFYTKE GIARERVENT SHPGEMQVTI 500
    QNLMPATVYI FRVMAQNKHG SGESSAPLRV ETQPEVQLPG PAPNLRAYAA 550
    SPTSITVTWE TPVSGNGEIQ NYKLYYMEKG TDKEQDVDVS SHSYTINGLK 600
    KYTEYSFRVV AYNKHGPGVS TPDVAVRTLS DVPSAAPQNL SLEVRNSKSI 650
    MIHWQPPAPA TQNGQITGYK IRYRKASRKS DVTETLVSGT QLSQLIEGLD 700
    RGTEYNFRVA ALTINGTGPA TDWLSAETFE SDLDETRVPE VPSSLHVRPL 750
    VTSIVVSWTP PENQNIVVRG YAIGYGIGSP HAQTIKVDYK QRYYTIENLD 800
    PSSHYVITLK AFNNVGEGIP LYESAVTRPH TDTSEVDLFV INAPYTPVPD 850
    PTPMMPPVGV QASILSHDTI RITWADNSLP KHQKITDSRY YTVRWKTNIP 900
    ANTKYKNANA TTLSYLVTGL KPNTLYEFSV MVTKGRRSST WSMTAHGTTF 950
    ELVPTSPPKD VTVVSKEGKP KTIIVNWQPP SEANGKITGY IIYYSTDVNA 1000
    EIHDWVIEPV VGNRLTHQIQ ELTLDTPYYF KIQARNSKGM GPMSEAVQFR 1050
    TPKADSSDKM PNDQASGSGG KGSRLPDLGS DYKPPMSGSN SPHGSPTSPL 1100
    DSNMLLVIIV SVGVITIVVV VIIAVFCTRR TTSHQKKKRA ACKSVNGSHK 1150
    YKGNSKDVKP PDLWIHHERL ELKPIDKSPD PNPIMTDTPI PRNSQDITPV 1200
    DNSMDSNIHQ RRNSYRGHES EDSMSTLAGR RGMRPKMMMP FDSQPPQPVI 1250
    SAHPIHSLDN PHHHFHSSSL ASPARSHLYH PGSPWPIGTS MSLSDRANST 1300
    ESVRNTPSTD TMPASSSQTC CTDHQDPEGA TSSSYLASSQ EEDSGQSLPT 1350
    AHVRPSHPLK SFAVPAIPPP GPPTYDPALP STPLLSQQAL NHHIHSVKTA 1400
    SIGTLGRSRP PMPVVVPSAP EVQETTRMLE DSESSYEPDE LTKEMAHLEG 1450
    LMKDLNAITT A 1461
    Length:1,461
    Mass (Da):160,017
    Last modified:October 17, 2006 - v2
    Checksum:i4AADF1EEBCAFD82C
    GO
    Isoform 2 (identifier: Q92859-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1248-1300: Missing.

    Show »
    Length:1,408
    Mass (Da):154,304
    Checksum:iE71D70CACE393061
    GO
    Isoform 3 (identifier: Q92859-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1248-1301: PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE → Q

    Note: No experimental confirmation available.

    Show »
    Length:1,408
    Mass (Da):154,303
    Checksum:i5E55E8130FF92C7C
    GO
    Isoform 4 (identifier: Q92859-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1054-1064: Missing.

    Show »
    Length:1,450
    Mass (Da):158,827
    Checksum:iCCD38B29A4B340D8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti168 – 1681N → G in AAB17263. (PubMed:9121761)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti534 – 5341P → L.
    Corresponds to variant rs4467039 [ dbSNP | Ensembl ].
    VAR_027954

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1054 – 106411Missing in isoform 4. 1 PublicationVSP_047134Add
    BLAST
    Alternative sequencei1248 – 130154PVISA…ANSTE → Q in isoform 3. 1 PublicationVSP_043330Add
    BLAST
    Alternative sequencei1248 – 130053Missing in isoform 2. 2 PublicationsVSP_002593Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U61262 mRNA. Translation: AAB17263.1.
    U72391 mRNA. Translation: AAC51287.1.
    AC068397 Genomic DNA. No translation available.
    AC104420 Genomic DNA. No translation available.
    AC129980 Genomic DNA. No translation available.
    BC117161 mRNA. Translation: AAI17162.1.
    BC143270 mRNA. Translation: AAI43271.1.
    BC143271 mRNA. Translation: AAI43272.1.
    CCDSiCCDS10247.1. [Q92859-1]
    CCDS53957.1. [Q92859-3]
    CCDS58378.1. [Q92859-4]
    RefSeqiNP_001166094.1. NM_001172623.1. [Q92859-3]
    NP_001166095.1. NM_001172624.1. [Q92859-4]
    NP_002490.2. NM_002499.3. [Q92859-1]
    XP_005254469.1. XM_005254412.1. [Q92859-1]
    XP_005254471.1. XM_005254414.1. [Q92859-4]
    XP_005254473.1. XM_005254416.1. [Q92859-3]
    UniGeneiHs.388613.

    Genome annotation databases

    EnsembliENST00000261908; ENSP00000261908; ENSG00000067141. [Q92859-1]
    ENST00000339362; ENSP00000341198; ENSG00000067141. [Q92859-1]
    ENST00000558964; ENSP00000453200; ENSG00000067141. [Q92859-4]
    ENST00000560262; ENSP00000453317; ENSG00000067141. [Q92859-3]
    GeneIDi4756.
    KEGGihsa:4756.
    UCSCiuc002avm.4. human. [Q92859-1]
    uc002avn.4. human.
    uc010uky.2. human. [Q92859-3]

    Polymorphism databases

    DMDMi116242676.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U61262 mRNA. Translation: AAB17263.1 .
    U72391 mRNA. Translation: AAC51287.1 .
    AC068397 Genomic DNA. No translation available.
    AC104420 Genomic DNA. No translation available.
    AC129980 Genomic DNA. No translation available.
    BC117161 mRNA. Translation: AAI17162.1 .
    BC143270 mRNA. Translation: AAI43271.1 .
    BC143271 mRNA. Translation: AAI43272.1 .
    CCDSi CCDS10247.1. [Q92859-1 ]
    CCDS53957.1. [Q92859-3 ]
    CCDS58378.1. [Q92859-4 ]
    RefSeqi NP_001166094.1. NM_001172623.1. [Q92859-3 ]
    NP_001166095.1. NM_001172624.1. [Q92859-4 ]
    NP_002490.2. NM_002499.3. [Q92859-1 ]
    XP_005254469.1. XM_005254412.1. [Q92859-1 ]
    XP_005254471.1. XM_005254414.1. [Q92859-4 ]
    XP_005254473.1. XM_005254416.1. [Q92859-3 ]
    UniGenei Hs.388613.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1X5F NMR - A 429-535 [» ]
    1X5G NMR - A 529-631 [» ]
    1X5H NMR - A 623-741 [» ]
    1X5I NMR - A 719-831 [» ]
    1X5J NMR - A 853-952 [» ]
    1X5K NMR - A 944-1054 [» ]
    3P4L X-ray 1.80 A 853-1054 [» ]
    ProteinModelPortali Q92859.
    SMRi Q92859. Positions 53-1057.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110830. 7 interactions.
    DIPi DIP-46272N.
    IntActi Q92859. 2 interactions.
    STRINGi 9606.ENSP00000261908.

    PTM databases

    PhosphoSitei Q92859.

    Polymorphism databases

    DMDMi 116242676.

    Proteomic databases

    MaxQBi Q92859.
    PaxDbi Q92859.
    PRIDEi Q92859.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261908 ; ENSP00000261908 ; ENSG00000067141 . [Q92859-1 ]
    ENST00000339362 ; ENSP00000341198 ; ENSG00000067141 . [Q92859-1 ]
    ENST00000558964 ; ENSP00000453200 ; ENSG00000067141 . [Q92859-4 ]
    ENST00000560262 ; ENSP00000453317 ; ENSG00000067141 . [Q92859-3 ]
    GeneIDi 4756.
    KEGGi hsa:4756.
    UCSCi uc002avm.4. human. [Q92859-1 ]
    uc002avn.4. human.
    uc010uky.2. human. [Q92859-3 ]

    Organism-specific databases

    CTDi 4756.
    GeneCardsi GC15P073346.
    HGNCi HGNC:7754. NEO1.
    HPAi CAB009320.
    HPA027804.
    HPA027805.
    HPA027806.
    MIMi 601907. gene.
    neXtProti NX_Q92859.
    PharmGKBi PA31555.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG249790.
    HOGENOMi HOG000230686.
    HOVERGENi HBG005455.
    InParanoidi Q92859.
    KOi K06766.
    OMAi VRWKTNI.
    OrthoDBi EOG7RRF65.
    PhylomeDBi Q92859.
    TreeFami TF321506.

    Enzyme and pathway databases

    Reactomei REACT_21402. CDO in myogenesis.
    REACT_22237. Netrin-1 signaling.

    Miscellaneous databases

    ChiTaRSi NEO1. human.
    EvolutionaryTracei Q92859.
    GeneWikii NEO1.
    GenomeRNAii 4756.
    NextBioi 18324.
    PROi Q92859.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q92859.
    Bgeei Q92859.
    CleanExi HS_NEO1.
    Genevestigatori Q92859.

    Family and domain databases

    Gene3Di 2.60.40.10. 10 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR010560. Neogenin_C.
    [Graphical view ]
    Pfami PF00041. fn3. 6 hits.
    PF07679. I-set. 3 hits.
    PF06583. Neogenin_C. 1 hit.
    [Graphical view ]
    SMARTi SM00060. FN3. 6 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 3 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 4 hits.
    PROSITEi PS50853. FN3. 6 hits.
    PS50835. IG_LIKE. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of neogenin, a DCC-related gene."
      Meyerhardt J.A., Look A.T., Bigner S.H., Fearon E.R.
      Oncogene 14:1129-1136(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Fetal brain.
    2. "Molecular characterization of human neogenin, a DCC-related protein, and the mapping of its gene (NEO1) to chromosomal position 15q22.3-q23."
      Vielmetter J., Chen X.-N., Miskevich F., Lane R.P., Yamakawa K., Korenberg J.R., Dreyer W.J.
      Genomics 41:414-421(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Fetal brain.
    3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Brain.
    5. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210 AND ASN-489.
      Tissue: Plasma.
    6. "Neogenin: A multi-functional receptor regulating diverse developmental processes."
      Cole S.J., Bradford D., Cooper H.M.
      Int. J. Biochem. Cell Biol. 39:1569-1575(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    7. "Selective binding of RGMc/hemojuvelin, a key protein in systemic iron metabolism, to BMP-2 and neogenin."
      Kuns-Hashimoto R., Kuninger D., Nili M., Rotwein P.
      Am. J. Physiol. 294:C994-C1003(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RBMC.
    8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210; ASN-470 AND ASN-639.
      Tissue: Leukemic T-cell.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. Cited for: FUNCTION, INTERACTION WITH BMP FAMILY MEMBERS, MISCELLANEOUS.
    11. "The solution structure of the six fibronectin type III domains of human neogenin."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 429-1054.

    Entry informationi

    Entry nameiNEO1_HUMAN
    AccessioniPrimary (citable) accession number: Q92859
    Secondary accession number(s): B7ZKM9
    , B7ZKN0, O00340, Q17RX1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 152 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Knockdown of NEO1 in C2C12 cells results in the enhancement of the BMP-2-induced processes of osteoblastic differentiation and phosphorylation of Smad1, Smad5, and Smad8. Conversely, overexpression suppresses these processes.

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3