Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neogenin

Gene

NEO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response.1 Publication

GO - Molecular functioni

  • co-receptor binding Source: BHF-UCL
  • receptor activity Source: InterPro

GO - Biological processi

  • axon guidance Source: InterPro
  • cell adhesion Source: ProtInc
  • iron ion homeostasis Source: MGI
  • positive regulation of BMP signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000067141-MONOMER.
ReactomeiR-HSA-373752. Netrin-1 signaling.
R-HSA-375170. CDO in myogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Neogenin
Alternative name(s):
Immunoglobulin superfamily DCC subclass member 2
Gene namesi
Name:NEO1
Synonyms:IGDCC2, NGN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:7754. NEO1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini34 – 1105ExtracellularSequence analysisAdd BLAST1072
Transmembranei1106 – 1126HelicalSequence analysisAdd BLAST21
Topological domaini1127 – 1461CytoplasmicSequence analysisAdd BLAST335

GO - Cellular componenti

  • Golgi apparatus Source: HPA
  • integral component of plasma membrane Source: ProtInc
  • nucleoplasm Source: HPA
  • plasma membrane Source: HPA
  • plasma membrane protein complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4756.
OpenTargetsiENSG00000067141.
PharmGKBiPA31555.

Polymorphism and mutation databases

BioMutaiNEO1.
DMDMi116242676.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 33Sequence analysisAdd BLAST33
ChainiPRO_000001504334 – 1461NeogeninAdd BLAST1428

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi73N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi74 ↔ 129PROSITE-ProRule annotation
Disulfide bondi173 ↔ 221PROSITE-ProRule annotation
Glycosylationi210N-linked (GlcNAc...)2 Publications1
Disulfide bondi270 ↔ 320PROSITE-ProRule annotation
Glycosylationi326N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi362 ↔ 410PROSITE-ProRule annotation
Glycosylationi470N-linked (GlcNAc...)1 Publication1
Glycosylationi489N-linked (GlcNAc...)1 Publication1
Glycosylationi639N-linked (GlcNAc...)1 Publication1
Glycosylationi715N-linked (GlcNAc...)Sequence analysis1
Glycosylationi909N-linked (GlcNAc...)Sequence analysis1
Modified residuei1178PhosphoserineBy similarity1
Modified residuei1194PhosphoserineCombined sources1
Modified residuei1198PhosphothreonineCombined sources1
Modified residuei1401PhosphoserineCombined sources1
Modified residuei1404PhosphothreonineCombined sources1
Modified residuei1432PhosphoserineBy similarity1
Modified residuei1434PhosphoserineCombined sources1
Modified residuei1435PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ92859.
PaxDbiQ92859.
PeptideAtlasiQ92859.
PRIDEiQ92859.

PTM databases

iPTMnetiQ92859.
PhosphoSitePlusiQ92859.

Expressioni

Tissue specificityi

Widely expressed and also in cancer cell lines.

Gene expression databases

BgeeiENSG00000067141.
CleanExiHS_NEO1.
ExpressionAtlasiQ92859. baseline and differential.
GenevisibleiQ92859. HS.

Organism-specific databases

HPAiCAB009320.
HPA027804.
HPA027805.
HPA027806.

Interactioni

Subunit structurei

Interacts with MYO10 (By similarity). Interacts with RGMA and RGMB. Interacts with BMP2, BMP4, BMP6, and BMP7.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HFE2Q6ZVN83EBI-2829116,EBI-10900704

GO - Molecular functioni

  • co-receptor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi110830. 7 interactors.
DIPiDIP-46272N.
IntActiQ92859. 4 interactors.
STRINGi9606.ENSP00000261908.

Structurei

Secondary structure

11461
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi443 – 450Combined sources8
Beta strandi455 – 460Combined sources6
Beta strandi470 – 479Combined sources10
Beta strandi486 – 489Combined sources4
Beta strandi496 – 500Combined sources5
Beta strandi508 – 516Combined sources9
Beta strandi521 – 524Combined sources4
Beta strandi528 – 531Combined sources4
Beta strandi546 – 551Combined sources6
Beta strandi554 – 558Combined sources5
Beta strandi570 – 578Combined sources9
Beta strandi587 – 589Combined sources3
Beta strandi591 – 596Combined sources6
Beta strandi604 – 612Combined sources9
Beta strandi638 – 643Combined sources6
Beta strandi646 – 655Combined sources10
Turni659 – 661Combined sources3
Beta strandi666 – 670Combined sources5
Beta strandi672 – 675Combined sources4
Beta strandi678 – 683Combined sources6
Beta strandi693 – 697Combined sources5
Beta strandi704 – 708Combined sources5
Beta strandi710 – 713Combined sources4
Beta strandi716 – 720Combined sources5
Beta strandi724 – 727Combined sources4
Beta strandi743 – 750Combined sources8
Beta strandi753 – 759Combined sources7
Beta strandi770 – 775Combined sources6
Helixi780 – 782Combined sources3
Beta strandi783 – 786Combined sources4
Beta strandi793 – 796Combined sources4
Beta strandi808 – 812Combined sources5
Beta strandi858 – 864Combined sources7
Beta strandi866 – 868Combined sources3
Beta strandi870 – 875Combined sources6
Beta strandi881 – 883Combined sources3
Beta strandi890 – 897Combined sources8
Beta strandi906 – 917Combined sources12
Beta strandi925 – 934Combined sources10
Beta strandi945 – 948Combined sources4
Beta strandi959 – 966Combined sources8
Beta strandi969 – 978Combined sources10
Beta strandi989 – 996Combined sources8
Beta strandi998 – 1000Combined sources3
Helixi1002 – 1004Combined sources3
Beta strandi1005 – 1013Combined sources9
Beta strandi1015 – 1019Combined sources5
Beta strandi1027 – 1036Combined sources10
Beta strandi1047 – 1050Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X5FNMR-A429-535[»]
1X5GNMR-A529-631[»]
1X5HNMR-A623-741[»]
1X5INMR-A719-831[»]
1X5JNMR-A853-952[»]
1X5KNMR-A944-1054[»]
3P4LX-ray1.80A853-1054[»]
ProteinModelPortaliQ92859.
SMRiQ92859.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92859.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 141Ig-like C2-type 1Add BLAST90
Domaini152 – 238Ig-like C2-type 2Add BLAST87
Domaini243 – 336Ig-like C2-type 3Add BLAST94
Domaini341 – 426Ig-like C2-type 4Add BLAST86
Domaini441 – 535Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini541 – 631Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST91
Domaini636 – 731Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini741 – 831Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST91
Domaini856 – 952Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST97
Domaini957 – 1054Fibronectin type-III 6PROSITE-ProRule annotationAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1118 – 1121Poly-Val4

Domaini

The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.By similarity

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. DCC family.Curated
Contains 6 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4221. Eukaryota.
ENOG410Z913. LUCA.
GeneTreeiENSGT00840000129688.
HOGENOMiHOG000230686.
HOVERGENiHBG005455.
InParanoidiQ92859.
KOiK06766.
OMAiMPPVGVQ.
OrthoDBiEOG091G098C.
PhylomeDBiQ92859.
TreeFamiTF321506.

Family and domain databases

CDDicd00063. FN3. 6 hits.
Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033024. Neogenin.
IPR010560. Neogenin_C.
[Graphical view]
PANTHERiPTHR10489:SF55. PTHR10489:SF55. 2 hits.
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 2 hits.
PF13895. Ig_2. 1 hit.
PF06583. Neogenin_C. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 6 hits.
SM00409. IG. 4 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 4 hits.
SSF49265. SSF49265. 4 hits.
PROSITEiPS50853. FN3. 6 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q92859-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAERGARRL LSTPSFWLYC LLLLGRRAPG AAAARSGSAP QSPGASIRTF
60 70 80 90 100
TPFYFLVEPV DTLSVRGSSV ILNCSAYSEP SPKIEWKKDG TFLNLVSDDR
110 120 130 140 150
RQLLPDGSLF ISNVVHSKHN KPDEGYYQCV ATVESLGTII SRTAKLIVAG
160 170 180 190 200
LPRFTSQPEP SSVYAGNNAI LNCEVNADLV PFVRWEQNRQ PLLLDDRVIK
210 220 230 240 250
LPSGMLVISN ATEGDGGLYR CVVESGGPPK YSDEVELKVL PDPEVISDLV
260 270 280 290 300
FLKQPSPLVR VIGQDVVLPC VASGLPTPTI KWMKNEEALD TESSERLVLL
310 320 330 340 350
AGGSLEISDV TEDDAGTYFC IADNGNETIE AQAELTVQAQ PEFLKQPTNI
360 370 380 390 400
YAHESMDIVF ECEVTGKPTP TVKWVKNGDM VIPSDYFKIV KEHNLQVLGL
410 420 430 440 450
VKSDEGFYQC IAENDVGNAQ AGAQLIILEH APATTGPLPS APRDVVASLV
460 470 480 490 500
STRFIKLTWR TPASDPHGDN LTYSVFYTKE GIARERVENT SHPGEMQVTI
510 520 530 540 550
QNLMPATVYI FRVMAQNKHG SGESSAPLRV ETQPEVQLPG PAPNLRAYAA
560 570 580 590 600
SPTSITVTWE TPVSGNGEIQ NYKLYYMEKG TDKEQDVDVS SHSYTINGLK
610 620 630 640 650
KYTEYSFRVV AYNKHGPGVS TPDVAVRTLS DVPSAAPQNL SLEVRNSKSI
660 670 680 690 700
MIHWQPPAPA TQNGQITGYK IRYRKASRKS DVTETLVSGT QLSQLIEGLD
710 720 730 740 750
RGTEYNFRVA ALTINGTGPA TDWLSAETFE SDLDETRVPE VPSSLHVRPL
760 770 780 790 800
VTSIVVSWTP PENQNIVVRG YAIGYGIGSP HAQTIKVDYK QRYYTIENLD
810 820 830 840 850
PSSHYVITLK AFNNVGEGIP LYESAVTRPH TDTSEVDLFV INAPYTPVPD
860 870 880 890 900
PTPMMPPVGV QASILSHDTI RITWADNSLP KHQKITDSRY YTVRWKTNIP
910 920 930 940 950
ANTKYKNANA TTLSYLVTGL KPNTLYEFSV MVTKGRRSST WSMTAHGTTF
960 970 980 990 1000
ELVPTSPPKD VTVVSKEGKP KTIIVNWQPP SEANGKITGY IIYYSTDVNA
1010 1020 1030 1040 1050
EIHDWVIEPV VGNRLTHQIQ ELTLDTPYYF KIQARNSKGM GPMSEAVQFR
1060 1070 1080 1090 1100
TPKADSSDKM PNDQASGSGG KGSRLPDLGS DYKPPMSGSN SPHGSPTSPL
1110 1120 1130 1140 1150
DSNMLLVIIV SVGVITIVVV VIIAVFCTRR TTSHQKKKRA ACKSVNGSHK
1160 1170 1180 1190 1200
YKGNSKDVKP PDLWIHHERL ELKPIDKSPD PNPIMTDTPI PRNSQDITPV
1210 1220 1230 1240 1250
DNSMDSNIHQ RRNSYRGHES EDSMSTLAGR RGMRPKMMMP FDSQPPQPVI
1260 1270 1280 1290 1300
SAHPIHSLDN PHHHFHSSSL ASPARSHLYH PGSPWPIGTS MSLSDRANST
1310 1320 1330 1340 1350
ESVRNTPSTD TMPASSSQTC CTDHQDPEGA TSSSYLASSQ EEDSGQSLPT
1360 1370 1380 1390 1400
AHVRPSHPLK SFAVPAIPPP GPPTYDPALP STPLLSQQAL NHHIHSVKTA
1410 1420 1430 1440 1450
SIGTLGRSRP PMPVVVPSAP EVQETTRMLE DSESSYEPDE LTKEMAHLEG
1460
LMKDLNAITT A
Length:1,461
Mass (Da):160,017
Last modified:October 17, 2006 - v2
Checksum:i4AADF1EEBCAFD82C
GO
Isoform 2 (identifier: Q92859-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1300: Missing.

Show »
Length:1,408
Mass (Da):154,304
Checksum:iE71D70CACE393061
GO
Isoform 3 (identifier: Q92859-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1301: PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE → Q

Note: No experimental confirmation available.
Show »
Length:1,408
Mass (Da):154,303
Checksum:i5E55E8130FF92C7C
GO
Isoform 4 (identifier: Q92859-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1054-1064: Missing.

Show »
Length:1,450
Mass (Da):158,827
Checksum:iCCD38B29A4B340D8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti168N → G in AAB17263 (PubMed:9121761).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027954534P → L.Corresponds to variant rs4467039dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471341054 – 1064Missing in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0433301248 – 1301PVISA…ANSTE → Q in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_0025931248 – 1300Missing in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61262 mRNA. Translation: AAB17263.1.
U72391 mRNA. Translation: AAC51287.1.
AC068397 Genomic DNA. No translation available.
AC104420 Genomic DNA. No translation available.
AC129980 Genomic DNA. No translation available.
BC117161 mRNA. Translation: AAI17162.1.
BC143270 mRNA. Translation: AAI43271.1.
BC143271 mRNA. Translation: AAI43272.1.
CCDSiCCDS10247.1. [Q92859-1]
CCDS53957.1. [Q92859-3]
CCDS58378.1. [Q92859-4]
RefSeqiNP_001166094.1. NM_001172623.1. [Q92859-3]
NP_001166095.1. NM_001172624.1. [Q92859-4]
NP_002490.2. NM_002499.3. [Q92859-1]
UniGeneiHs.388613.

Genome annotation databases

EnsembliENST00000261908; ENSP00000261908; ENSG00000067141. [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141. [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141. [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141. [Q92859-3]
GeneIDi4756.
KEGGihsa:4756.
UCSCiuc002avm.4. human. [Q92859-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61262 mRNA. Translation: AAB17263.1.
U72391 mRNA. Translation: AAC51287.1.
AC068397 Genomic DNA. No translation available.
AC104420 Genomic DNA. No translation available.
AC129980 Genomic DNA. No translation available.
BC117161 mRNA. Translation: AAI17162.1.
BC143270 mRNA. Translation: AAI43271.1.
BC143271 mRNA. Translation: AAI43272.1.
CCDSiCCDS10247.1. [Q92859-1]
CCDS53957.1. [Q92859-3]
CCDS58378.1. [Q92859-4]
RefSeqiNP_001166094.1. NM_001172623.1. [Q92859-3]
NP_001166095.1. NM_001172624.1. [Q92859-4]
NP_002490.2. NM_002499.3. [Q92859-1]
UniGeneiHs.388613.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X5FNMR-A429-535[»]
1X5GNMR-A529-631[»]
1X5HNMR-A623-741[»]
1X5INMR-A719-831[»]
1X5JNMR-A853-952[»]
1X5KNMR-A944-1054[»]
3P4LX-ray1.80A853-1054[»]
ProteinModelPortaliQ92859.
SMRiQ92859.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110830. 7 interactors.
DIPiDIP-46272N.
IntActiQ92859. 4 interactors.
STRINGi9606.ENSP00000261908.

PTM databases

iPTMnetiQ92859.
PhosphoSitePlusiQ92859.

Polymorphism and mutation databases

BioMutaiNEO1.
DMDMi116242676.

Proteomic databases

MaxQBiQ92859.
PaxDbiQ92859.
PeptideAtlasiQ92859.
PRIDEiQ92859.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261908; ENSP00000261908; ENSG00000067141. [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141. [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141. [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141. [Q92859-3]
GeneIDi4756.
KEGGihsa:4756.
UCSCiuc002avm.4. human. [Q92859-1]

Organism-specific databases

CTDi4756.
DisGeNETi4756.
GeneCardsiNEO1.
HGNCiHGNC:7754. NEO1.
HPAiCAB009320.
HPA027804.
HPA027805.
HPA027806.
MIMi601907. gene.
neXtProtiNX_Q92859.
OpenTargetsiENSG00000067141.
PharmGKBiPA31555.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4221. Eukaryota.
ENOG410Z913. LUCA.
GeneTreeiENSGT00840000129688.
HOGENOMiHOG000230686.
HOVERGENiHBG005455.
InParanoidiQ92859.
KOiK06766.
OMAiMPPVGVQ.
OrthoDBiEOG091G098C.
PhylomeDBiQ92859.
TreeFamiTF321506.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000067141-MONOMER.
ReactomeiR-HSA-373752. Netrin-1 signaling.
R-HSA-375170. CDO in myogenesis.

Miscellaneous databases

ChiTaRSiNEO1. human.
EvolutionaryTraceiQ92859.
GeneWikiiNEO1.
GenomeRNAii4756.
PROiQ92859.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000067141.
CleanExiHS_NEO1.
ExpressionAtlasiQ92859. baseline and differential.
GenevisibleiQ92859. HS.

Family and domain databases

CDDicd00063. FN3. 6 hits.
Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033024. Neogenin.
IPR010560. Neogenin_C.
[Graphical view]
PANTHERiPTHR10489:SF55. PTHR10489:SF55. 2 hits.
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 2 hits.
PF13895. Ig_2. 1 hit.
PF06583. Neogenin_C. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 6 hits.
SM00409. IG. 4 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 4 hits.
SSF49265. SSF49265. 4 hits.
PROSITEiPS50853. FN3. 6 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNEO1_HUMAN
AccessioniPrimary (citable) accession number: Q92859
Secondary accession number(s): B7ZKM9
, B7ZKN0, O00340, Q17RX1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 175 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Knockdown of NEO1 in C2C12 cells results in the enhancement of the BMP-2-induced processes of osteoblastic differentiation and phosphorylation of Smad1, Smad5, and Smad8. Conversely, overexpression suppresses these processes.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.