Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q92859 (NEO1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 147. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neogenin
Alternative name(s):
Immunoglobulin superfamily DCC subclass member 2
Gene names
Name:NEO1
Synonyms:IGDCC2, NGN
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1461 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved as a regulatory protein in the transition of undifferentiated proliferating cells to their differentiated state. May also function as a cell adhesion molecule in a broad spectrum of embryonic and adult tissues.

Subunit structure

Interacts with RGMA. Interacts with MYO10 By similarity.

Subcellular location

Cell membrane; Single-pass type I membrane protein.

Tissue specificity

Widely expressed and also in cancer cell lines.

Sequence similarities

Belongs to the immunoglobulin superfamily. DCC family.

Contains 6 fibronectin type-III domains.

Contains 4 Ig-like C2-type (immunoglobulin-like) domains.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q92859-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q92859-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1300: Missing.
Isoform 3 (identifier: Q92859-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1301: PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE → Q
Note: No experimental confirmation available.
Isoform 4 (identifier: Q92859-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1054-1064: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3333 Potential
Chain34 – 14611428Neogenin
PRO_0000015043

Regions

Topological domain34 – 11051072Extracellular Potential
Transmembrane1106 – 112621Helical; Potential
Topological domain1127 – 1461335Cytoplasmic Potential
Domain52 – 14190Ig-like C2-type 1
Domain152 – 23887Ig-like C2-type 2
Domain243 – 33694Ig-like C2-type 3
Domain341 – 42686Ig-like C2-type 4
Domain441 – 53595Fibronectin type-III 1
Domain541 – 63191Fibronectin type-III 2
Domain636 – 73196Fibronectin type-III 3
Domain741 – 83191Fibronectin type-III 4
Domain856 – 95297Fibronectin type-III 5
Domain957 – 105498Fibronectin type-III 6
Compositional bias1118 – 11214Poly-Val

Amino acid modifications

Glycosylation731N-linked (GlcNAc...) Potential
Glycosylation2101N-linked (GlcNAc...) Ref.5 Ref.6
Glycosylation3261N-linked (GlcNAc...) Potential
Glycosylation4701N-linked (GlcNAc...) Ref.6
Glycosylation4891N-linked (GlcNAc...) Ref.5
Glycosylation6391N-linked (GlcNAc...) Ref.6
Glycosylation7151N-linked (GlcNAc...) Potential
Glycosylation9091N-linked (GlcNAc...) Potential
Disulfide bond74 ↔ 129 By similarity
Disulfide bond173 ↔ 221 By similarity
Disulfide bond270 ↔ 320 By similarity
Disulfide bond362 ↔ 410 By similarity

Natural variations

Alternative sequence1054 – 106411Missing in isoform 4.
VSP_047134
Alternative sequence1248 – 130154PVISA…ANSTE → Q in isoform 3.
VSP_043330
Alternative sequence1248 – 130053Missing in isoform 2.
VSP_002593
Natural variant5341P → L.
Corresponds to variant rs4467039 [ dbSNP | Ensembl ].
VAR_027954

Experimental info

Sequence conflict1681N → G in AAB17263. Ref.1

Secondary structure

................................................................................................. 1461
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 2.
Checksum: 4AADF1EEBCAFD82C

FASTA1,461160,017
        10         20         30         40         50         60 
MAAERGARRL LSTPSFWLYC LLLLGRRAPG AAAARSGSAP QSPGASIRTF TPFYFLVEPV 

        70         80         90        100        110        120 
DTLSVRGSSV ILNCSAYSEP SPKIEWKKDG TFLNLVSDDR RQLLPDGSLF ISNVVHSKHN 

       130        140        150        160        170        180 
KPDEGYYQCV ATVESLGTII SRTAKLIVAG LPRFTSQPEP SSVYAGNNAI LNCEVNADLV 

       190        200        210        220        230        240 
PFVRWEQNRQ PLLLDDRVIK LPSGMLVISN ATEGDGGLYR CVVESGGPPK YSDEVELKVL 

       250        260        270        280        290        300 
PDPEVISDLV FLKQPSPLVR VIGQDVVLPC VASGLPTPTI KWMKNEEALD TESSERLVLL 

       310        320        330        340        350        360 
AGGSLEISDV TEDDAGTYFC IADNGNETIE AQAELTVQAQ PEFLKQPTNI YAHESMDIVF 

       370        380        390        400        410        420 
ECEVTGKPTP TVKWVKNGDM VIPSDYFKIV KEHNLQVLGL VKSDEGFYQC IAENDVGNAQ 

       430        440        450        460        470        480 
AGAQLIILEH APATTGPLPS APRDVVASLV STRFIKLTWR TPASDPHGDN LTYSVFYTKE 

       490        500        510        520        530        540 
GIARERVENT SHPGEMQVTI QNLMPATVYI FRVMAQNKHG SGESSAPLRV ETQPEVQLPG 

       550        560        570        580        590        600 
PAPNLRAYAA SPTSITVTWE TPVSGNGEIQ NYKLYYMEKG TDKEQDVDVS SHSYTINGLK 

       610        620        630        640        650        660 
KYTEYSFRVV AYNKHGPGVS TPDVAVRTLS DVPSAAPQNL SLEVRNSKSI MIHWQPPAPA 

       670        680        690        700        710        720 
TQNGQITGYK IRYRKASRKS DVTETLVSGT QLSQLIEGLD RGTEYNFRVA ALTINGTGPA 

       730        740        750        760        770        780 
TDWLSAETFE SDLDETRVPE VPSSLHVRPL VTSIVVSWTP PENQNIVVRG YAIGYGIGSP 

       790        800        810        820        830        840 
HAQTIKVDYK QRYYTIENLD PSSHYVITLK AFNNVGEGIP LYESAVTRPH TDTSEVDLFV 

       850        860        870        880        890        900 
INAPYTPVPD PTPMMPPVGV QASILSHDTI RITWADNSLP KHQKITDSRY YTVRWKTNIP 

       910        920        930        940        950        960 
ANTKYKNANA TTLSYLVTGL KPNTLYEFSV MVTKGRRSST WSMTAHGTTF ELVPTSPPKD 

       970        980        990       1000       1010       1020 
VTVVSKEGKP KTIIVNWQPP SEANGKITGY IIYYSTDVNA EIHDWVIEPV VGNRLTHQIQ 

      1030       1040       1050       1060       1070       1080 
ELTLDTPYYF KIQARNSKGM GPMSEAVQFR TPKADSSDKM PNDQASGSGG KGSRLPDLGS 

      1090       1100       1110       1120       1130       1140 
DYKPPMSGSN SPHGSPTSPL DSNMLLVIIV SVGVITIVVV VIIAVFCTRR TTSHQKKKRA 

      1150       1160       1170       1180       1190       1200 
ACKSVNGSHK YKGNSKDVKP PDLWIHHERL ELKPIDKSPD PNPIMTDTPI PRNSQDITPV 

      1210       1220       1230       1240       1250       1260 
DNSMDSNIHQ RRNSYRGHES EDSMSTLAGR RGMRPKMMMP FDSQPPQPVI SAHPIHSLDN 

      1270       1280       1290       1300       1310       1320 
PHHHFHSSSL ASPARSHLYH PGSPWPIGTS MSLSDRANST ESVRNTPSTD TMPASSSQTC 

      1330       1340       1350       1360       1370       1380 
CTDHQDPEGA TSSSYLASSQ EEDSGQSLPT AHVRPSHPLK SFAVPAIPPP GPPTYDPALP 

      1390       1400       1410       1420       1430       1440 
STPLLSQQAL NHHIHSVKTA SIGTLGRSRP PMPVVVPSAP EVQETTRMLE DSESSYEPDE 

      1450       1460 
LTKEMAHLEG LMKDLNAITT A 

« Hide

Isoform 2 [UniParc].

Checksum: E71D70CACE393061
Show »

FASTA1,408154,304
Isoform 3 [UniParc].

Checksum: 5E55E8130FF92C7C
Show »

FASTA1,408154,303
Isoform 4 [UniParc].

Checksum: CCD38B29A4B340D8
Show »

FASTA1,450158,827

References

« Hide 'large scale' references
[1]"Identification and characterization of neogenin, a DCC-related gene."
Meyerhardt J.A., Look A.T., Bigner S.H., Fearon E.R.
Oncogene 14:1129-1136(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Fetal brain.
[2]"Molecular characterization of human neogenin, a DCC-related protein, and the mapping of its gene (NEO1) to chromosomal position 15q22.3-q23."
Vielmetter J., Chen X.-N., Miskevich F., Lane R.P., Yamakawa K., Korenberg J.R., Dreyer W.J.
Genomics 41:414-421(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Fetal brain.
[3]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: Brain.
[5]"Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210 AND ASN-489.
Tissue: Plasma.
[6]"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210; ASN-470 AND ASN-639.
Tissue: Leukemic T-cell.
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"The solution structure of the six fibronectin type III domains of human neogenin."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2005) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 429-1054.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U61262 mRNA. Translation: AAB17263.1.
U72391 mRNA. Translation: AAC51287.1.
AC068397 Genomic DNA. No translation available.
AC104420 Genomic DNA. No translation available.
AC129980 Genomic DNA. No translation available.
BC117161 mRNA. Translation: AAI17162.1.
BC143270 mRNA. Translation: AAI43271.1.
BC143271 mRNA. Translation: AAI43272.1.
RefSeqNP_001166094.1. NM_001172623.1.
NP_001166095.1. NM_001172624.1.
NP_002490.2. NM_002499.3.
XP_005254469.1. XM_005254412.1.
XP_005254471.1. XM_005254414.1.
XP_005254473.1. XM_005254416.1.
UniGeneHs.388613.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1X5FNMR-A429-535[»]
1X5GNMR-A529-631[»]
1X5HNMR-A623-741[»]
1X5INMR-A718-831[»]
1X5JNMR-A853-952[»]
1X5KNMR-A944-1054[»]
3P4LX-ray1.80A853-1054[»]
ProteinModelPortalQ92859.
SMRQ92859. Positions 26-1057.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110830. 7 interactions.
DIPDIP-46272N.
IntActQ92859. 2 interactions.
STRING9606.ENSP00000261908.

PTM databases

PhosphoSiteQ92859.

Polymorphism databases

DMDM116242676.

Proteomic databases

PaxDbQ92859.
PRIDEQ92859.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261908; ENSP00000261908; ENSG00000067141. [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141. [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141. [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141. [Q92859-3]
GeneID4756.
KEGGhsa:4756.
UCSCuc002avm.4. human. [Q92859-1]
uc002avn.4. human.
uc010uky.2. human. [Q92859-3]

Organism-specific databases

CTD4756.
GeneCardsGC15P073346.
HGNCHGNC:7754. NEO1.
HPACAB009320.
HPA027804.
HPA027805.
HPA027806.
MIM601907. gene.
neXtProtNX_Q92859.
PharmGKBPA31555.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG249790.
HOGENOMHOG000230686.
HOVERGENHBG005455.
InParanoidQ92859.
KOK06766.
OMAVRWKTNI.
OrthoDBEOG7RRF65.
PhylomeDBQ92859.
TreeFamTF321506.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
REACT_194409. Developmental Biology.

Gene expression databases

ArrayExpressQ92859.
BgeeQ92859.
CleanExHS_NEO1.
GenevestigatorQ92859.

Family and domain databases

Gene3D2.60.40.10. 10 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR010560. Neogenin_C.
[Graphical view]
PfamPF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF06583. Neogenin_C. 1 hit.
[Graphical view]
SMARTSM00060. FN3. 6 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 4 hits.
PROSITEPS50853. FN3. 6 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNEO1. human.
EvolutionaryTraceQ92859.
GeneWikiNEO1.
GenomeRNAi4756.
NextBio18324.
PROQ92859.
SOURCESearch...

Entry information

Entry nameNEO1_HUMAN
AccessionPrimary (citable) accession number: Q92859
Secondary accession number(s): B7ZKM9 expand/collapse secondary AC list , B7ZKN0, O00340, Q17RX1
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 17, 2006
Last modified: April 16, 2014
This is version 147 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM