SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92859

- NEO1_HUMAN

UniProt

Q92859 - NEO1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neogenin

Gene
NEO1, IGDCC2, NGN
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response.

GO - Molecular functioni

  1. receptor activity Source: Ensembl

GO - Biological processi

  1. axon guidance Source: Reactome
  2. cell adhesion Source: ProtInc
  3. iron ion homeostasis Source: MGI
  4. muscle cell differentiation Source: Reactome
  5. myoblast fusion Source: Ensembl
  6. positive regulation of muscle cell differentiation Source: Reactome
  7. regulation of transcription, DNA-templated Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_21402. CDO in myogenesis.
REACT_22237. Netrin-1 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Neogenin
Alternative name(s):
Immunoglobulin superfamily DCC subclass member 2
Gene namesi
Name:NEO1
Synonyms:IGDCC2, NGN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:7754. NEO1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini34 – 11051072Extracellular Reviewed predictionAdd
BLAST
Transmembranei1106 – 112621Helical; Reviewed predictionAdd
BLAST
Topological domaini1127 – 1461335Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31555.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3333 Reviewed predictionAdd
BLAST
Chaini34 – 14611428NeogeninPRO_0000015043Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi73 – 731N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi74 ↔ 129 By similarity
Disulfide bondi173 ↔ 221 By similarity
Glycosylationi210 – 2101N-linked (GlcNAc...)2 Publications
Disulfide bondi270 ↔ 320 By similarity
Glycosylationi326 – 3261N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi362 ↔ 410 By similarity
Glycosylationi470 – 4701N-linked (GlcNAc...)1 Publication
Glycosylationi489 – 4891N-linked (GlcNAc...)1 Publication
Glycosylationi639 – 6391N-linked (GlcNAc...)1 Publication
Glycosylationi715 – 7151N-linked (GlcNAc...) Reviewed prediction
Glycosylationi909 – 9091N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ92859.
PaxDbiQ92859.
PRIDEiQ92859.

PTM databases

PhosphoSiteiQ92859.

Expressioni

Tissue specificityi

Widely expressed and also in cancer cell lines.

Gene expression databases

ArrayExpressiQ92859.
BgeeiQ92859.
CleanExiHS_NEO1.
GenevestigatoriQ92859.

Organism-specific databases

HPAiCAB009320.
HPA027804.
HPA027805.
HPA027806.

Interactioni

Subunit structurei

Interacts with MYO10 By similarity. Interacts with RGMA and RGMB. Interacts with BMP2, BMP4, BMP6, and BMP7.

Protein-protein interaction databases

BioGridi110830. 7 interactions.
DIPiDIP-46272N.
IntActiQ92859. 2 interactions.
STRINGi9606.ENSP00000261908.

Structurei

Secondary structure

1
1461
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi443 – 4508
Beta strandi455 – 4606
Beta strandi470 – 47910
Beta strandi486 – 4894
Beta strandi496 – 5005
Beta strandi508 – 5169
Beta strandi521 – 5244
Beta strandi528 – 5314
Beta strandi546 – 5516
Beta strandi554 – 5585
Beta strandi570 – 5789
Beta strandi587 – 5893
Beta strandi591 – 5966
Beta strandi604 – 6129
Beta strandi638 – 6436
Beta strandi646 – 65510
Turni659 – 6613
Beta strandi666 – 6705
Beta strandi672 – 6754
Beta strandi678 – 6836
Beta strandi693 – 6975
Beta strandi704 – 7085
Beta strandi710 – 7134
Beta strandi716 – 7205
Beta strandi724 – 7274
Beta strandi743 – 7508
Beta strandi753 – 7597
Beta strandi770 – 7756
Helixi780 – 7823
Beta strandi783 – 7864
Beta strandi793 – 7964
Beta strandi808 – 8125
Beta strandi858 – 8647
Beta strandi866 – 8683
Beta strandi870 – 8756
Beta strandi881 – 8833
Beta strandi890 – 8978
Beta strandi906 – 91712
Beta strandi925 – 93410
Beta strandi945 – 9484
Beta strandi959 – 9668
Beta strandi969 – 97810
Beta strandi989 – 9968
Beta strandi998 – 10003
Helixi1002 – 10043
Beta strandi1005 – 10139
Beta strandi1015 – 10195
Beta strandi1027 – 103610
Beta strandi1047 – 10504

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X5FNMR-A429-535[»]
1X5GNMR-A529-631[»]
1X5HNMR-A623-741[»]
1X5INMR-A719-831[»]
1X5JNMR-A853-952[»]
1X5KNMR-A944-1054[»]
3P4LX-ray1.80A853-1054[»]
ProteinModelPortaliQ92859.
SMRiQ92859. Positions 53-1057.

Miscellaneous databases

EvolutionaryTraceiQ92859.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 14190Ig-like C2-type 1Add
BLAST
Domaini152 – 23887Ig-like C2-type 2Add
BLAST
Domaini243 – 33694Ig-like C2-type 3Add
BLAST
Domaini341 – 42686Ig-like C2-type 4Add
BLAST
Domaini441 – 53595Fibronectin type-III 1Add
BLAST
Domaini541 – 63191Fibronectin type-III 2Add
BLAST
Domaini636 – 73196Fibronectin type-III 3Add
BLAST
Domaini741 – 83191Fibronectin type-III 4Add
BLAST
Domaini856 – 95297Fibronectin type-III 5Add
BLAST
Domaini957 – 105498Fibronectin type-III 6Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1118 – 11214Poly-Val

Domaini

The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules By similarity.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG249790.
HOGENOMiHOG000230686.
HOVERGENiHBG005455.
InParanoidiQ92859.
KOiK06766.
OMAiVRWKTNI.
OrthoDBiEOG7RRF65.
PhylomeDBiQ92859.
TreeFamiTF321506.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR010560. Neogenin_C.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF06583. Neogenin_C. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 6 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 4 hits.
PROSITEiPS50853. FN3. 6 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q92859-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAERGARRL LSTPSFWLYC LLLLGRRAPG AAAARSGSAP QSPGASIRTF     50
TPFYFLVEPV DTLSVRGSSV ILNCSAYSEP SPKIEWKKDG TFLNLVSDDR 100
RQLLPDGSLF ISNVVHSKHN KPDEGYYQCV ATVESLGTII SRTAKLIVAG 150
LPRFTSQPEP SSVYAGNNAI LNCEVNADLV PFVRWEQNRQ PLLLDDRVIK 200
LPSGMLVISN ATEGDGGLYR CVVESGGPPK YSDEVELKVL PDPEVISDLV 250
FLKQPSPLVR VIGQDVVLPC VASGLPTPTI KWMKNEEALD TESSERLVLL 300
AGGSLEISDV TEDDAGTYFC IADNGNETIE AQAELTVQAQ PEFLKQPTNI 350
YAHESMDIVF ECEVTGKPTP TVKWVKNGDM VIPSDYFKIV KEHNLQVLGL 400
VKSDEGFYQC IAENDVGNAQ AGAQLIILEH APATTGPLPS APRDVVASLV 450
STRFIKLTWR TPASDPHGDN LTYSVFYTKE GIARERVENT SHPGEMQVTI 500
QNLMPATVYI FRVMAQNKHG SGESSAPLRV ETQPEVQLPG PAPNLRAYAA 550
SPTSITVTWE TPVSGNGEIQ NYKLYYMEKG TDKEQDVDVS SHSYTINGLK 600
KYTEYSFRVV AYNKHGPGVS TPDVAVRTLS DVPSAAPQNL SLEVRNSKSI 650
MIHWQPPAPA TQNGQITGYK IRYRKASRKS DVTETLVSGT QLSQLIEGLD 700
RGTEYNFRVA ALTINGTGPA TDWLSAETFE SDLDETRVPE VPSSLHVRPL 750
VTSIVVSWTP PENQNIVVRG YAIGYGIGSP HAQTIKVDYK QRYYTIENLD 800
PSSHYVITLK AFNNVGEGIP LYESAVTRPH TDTSEVDLFV INAPYTPVPD 850
PTPMMPPVGV QASILSHDTI RITWADNSLP KHQKITDSRY YTVRWKTNIP 900
ANTKYKNANA TTLSYLVTGL KPNTLYEFSV MVTKGRRSST WSMTAHGTTF 950
ELVPTSPPKD VTVVSKEGKP KTIIVNWQPP SEANGKITGY IIYYSTDVNA 1000
EIHDWVIEPV VGNRLTHQIQ ELTLDTPYYF KIQARNSKGM GPMSEAVQFR 1050
TPKADSSDKM PNDQASGSGG KGSRLPDLGS DYKPPMSGSN SPHGSPTSPL 1100
DSNMLLVIIV SVGVITIVVV VIIAVFCTRR TTSHQKKKRA ACKSVNGSHK 1150
YKGNSKDVKP PDLWIHHERL ELKPIDKSPD PNPIMTDTPI PRNSQDITPV 1200
DNSMDSNIHQ RRNSYRGHES EDSMSTLAGR RGMRPKMMMP FDSQPPQPVI 1250
SAHPIHSLDN PHHHFHSSSL ASPARSHLYH PGSPWPIGTS MSLSDRANST 1300
ESVRNTPSTD TMPASSSQTC CTDHQDPEGA TSSSYLASSQ EEDSGQSLPT 1350
AHVRPSHPLK SFAVPAIPPP GPPTYDPALP STPLLSQQAL NHHIHSVKTA 1400
SIGTLGRSRP PMPVVVPSAP EVQETTRMLE DSESSYEPDE LTKEMAHLEG 1450
LMKDLNAITT A 1461
Length:1,461
Mass (Da):160,017
Last modified:October 17, 2006 - v2
Checksum:i4AADF1EEBCAFD82C
GO
Isoform 2 (identifier: Q92859-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1300: Missing.

Show »
Length:1,408
Mass (Da):154,304
Checksum:iE71D70CACE393061
GO
Isoform 3 (identifier: Q92859-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1301: PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE → Q

Note: No experimental confirmation available.

Show »
Length:1,408
Mass (Da):154,303
Checksum:i5E55E8130FF92C7C
GO
Isoform 4 (identifier: Q92859-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1054-1064: Missing.

Show »
Length:1,450
Mass (Da):158,827
Checksum:iCCD38B29A4B340D8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti534 – 5341P → L.
Corresponds to variant rs4467039 [ dbSNP | Ensembl ].
VAR_027954

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1054 – 106411Missing in isoform 4. VSP_047134Add
BLAST
Alternative sequencei1248 – 130154PVISA…ANSTE → Q in isoform 3. VSP_043330Add
BLAST
Alternative sequencei1248 – 130053Missing in isoform 2. VSP_002593Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti168 – 1681N → G in AAB17263. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U61262 mRNA. Translation: AAB17263.1.
U72391 mRNA. Translation: AAC51287.1.
AC068397 Genomic DNA. No translation available.
AC104420 Genomic DNA. No translation available.
AC129980 Genomic DNA. No translation available.
BC117161 mRNA. Translation: AAI17162.1.
BC143270 mRNA. Translation: AAI43271.1.
BC143271 mRNA. Translation: AAI43272.1.
CCDSiCCDS10247.1. [Q92859-1]
CCDS53957.1. [Q92859-3]
CCDS58378.1. [Q92859-4]
RefSeqiNP_001166094.1. NM_001172623.1. [Q92859-3]
NP_001166095.1. NM_001172624.1. [Q92859-4]
NP_002490.2. NM_002499.3. [Q92859-1]
XP_005254469.1. XM_005254412.1. [Q92859-1]
XP_005254471.1. XM_005254414.1. [Q92859-4]
XP_005254473.1. XM_005254416.1. [Q92859-3]
UniGeneiHs.388613.

Genome annotation databases

EnsembliENST00000261908; ENSP00000261908; ENSG00000067141. [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141. [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141. [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141. [Q92859-3]
GeneIDi4756.
KEGGihsa:4756.
UCSCiuc002avm.4. human. [Q92859-1]
uc002avn.4. human.
uc010uky.2. human. [Q92859-3]

Polymorphism databases

DMDMi116242676.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U61262 mRNA. Translation: AAB17263.1 .
U72391 mRNA. Translation: AAC51287.1 .
AC068397 Genomic DNA. No translation available.
AC104420 Genomic DNA. No translation available.
AC129980 Genomic DNA. No translation available.
BC117161 mRNA. Translation: AAI17162.1 .
BC143270 mRNA. Translation: AAI43271.1 .
BC143271 mRNA. Translation: AAI43272.1 .
CCDSi CCDS10247.1. [Q92859-1 ]
CCDS53957.1. [Q92859-3 ]
CCDS58378.1. [Q92859-4 ]
RefSeqi NP_001166094.1. NM_001172623.1. [Q92859-3 ]
NP_001166095.1. NM_001172624.1. [Q92859-4 ]
NP_002490.2. NM_002499.3. [Q92859-1 ]
XP_005254469.1. XM_005254412.1. [Q92859-1 ]
XP_005254471.1. XM_005254414.1. [Q92859-4 ]
XP_005254473.1. XM_005254416.1. [Q92859-3 ]
UniGenei Hs.388613.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1X5F NMR - A 429-535 [» ]
1X5G NMR - A 529-631 [» ]
1X5H NMR - A 623-741 [» ]
1X5I NMR - A 719-831 [» ]
1X5J NMR - A 853-952 [» ]
1X5K NMR - A 944-1054 [» ]
3P4L X-ray 1.80 A 853-1054 [» ]
ProteinModelPortali Q92859.
SMRi Q92859. Positions 53-1057.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110830. 7 interactions.
DIPi DIP-46272N.
IntActi Q92859. 2 interactions.
STRINGi 9606.ENSP00000261908.

PTM databases

PhosphoSitei Q92859.

Polymorphism databases

DMDMi 116242676.

Proteomic databases

MaxQBi Q92859.
PaxDbi Q92859.
PRIDEi Q92859.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261908 ; ENSP00000261908 ; ENSG00000067141 . [Q92859-1 ]
ENST00000339362 ; ENSP00000341198 ; ENSG00000067141 . [Q92859-1 ]
ENST00000558964 ; ENSP00000453200 ; ENSG00000067141 . [Q92859-4 ]
ENST00000560262 ; ENSP00000453317 ; ENSG00000067141 . [Q92859-3 ]
GeneIDi 4756.
KEGGi hsa:4756.
UCSCi uc002avm.4. human. [Q92859-1 ]
uc002avn.4. human.
uc010uky.2. human. [Q92859-3 ]

Organism-specific databases

CTDi 4756.
GeneCardsi GC15P073346.
HGNCi HGNC:7754. NEO1.
HPAi CAB009320.
HPA027804.
HPA027805.
HPA027806.
MIMi 601907. gene.
neXtProti NX_Q92859.
PharmGKBi PA31555.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG249790.
HOGENOMi HOG000230686.
HOVERGENi HBG005455.
InParanoidi Q92859.
KOi K06766.
OMAi VRWKTNI.
OrthoDBi EOG7RRF65.
PhylomeDBi Q92859.
TreeFami TF321506.

Enzyme and pathway databases

Reactomei REACT_21402. CDO in myogenesis.
REACT_22237. Netrin-1 signaling.

Miscellaneous databases

ChiTaRSi NEO1. human.
EvolutionaryTracei Q92859.
GeneWikii NEO1.
GenomeRNAii 4756.
NextBioi 18324.
PROi Q92859.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q92859.
Bgeei Q92859.
CleanExi HS_NEO1.
Genevestigatori Q92859.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR010560. Neogenin_C.
[Graphical view ]
Pfami PF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF06583. Neogenin_C. 1 hit.
[Graphical view ]
SMARTi SM00060. FN3. 6 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 3 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 4 hits.
PROSITEi PS50853. FN3. 6 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of neogenin, a DCC-related gene."
    Meyerhardt J.A., Look A.T., Bigner S.H., Fearon E.R.
    Oncogene 14:1129-1136(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Fetal brain.
  2. "Molecular characterization of human neogenin, a DCC-related protein, and the mapping of its gene (NEO1) to chromosomal position 15q22.3-q23."
    Vielmetter J., Chen X.-N., Miskevich F., Lane R.P., Yamakawa K., Korenberg J.R., Dreyer W.J.
    Genomics 41:414-421(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Fetal brain.
  3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Brain.
  5. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210 AND ASN-489.
    Tissue: Plasma.
  6. "Neogenin: A multi-functional receptor regulating diverse developmental processes."
    Cole S.J., Bradford D., Cooper H.M.
    Int. J. Biochem. Cell Biol. 39:1569-1575(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  7. "Selective binding of RGMc/hemojuvelin, a key protein in systemic iron metabolism, to BMP-2 and neogenin."
    Kuns-Hashimoto R., Kuninger D., Nili M., Rotwein P.
    Am. J. Physiol. 294:C994-C1003(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RBMC.
  8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-210; ASN-470 AND ASN-639.
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. Cited for: FUNCTION, INTERACTION WITH BMP FAMILY MEMBERS, MISCELLANEOUS.
  11. "The solution structure of the six fibronectin type III domains of human neogenin."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 429-1054.

Entry informationi

Entry nameiNEO1_HUMAN
AccessioniPrimary (citable) accession number: Q92859
Secondary accession number(s): B7ZKM9
, B7ZKN0, O00340, Q17RX1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Knockdown of NEO1 in C2C12 cells results in the enhancement of the BMP-2-induced processes of osteoblastic differentiation and phosphorylation of Smad1, Smad5, and Smad8. Conversely, overexpression suppresses these processes.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi