Reviewed,
UniProtKB/Swiss-Prot Q92851 (CASPA_HUMAN)
Last modified
November 25, 2008.
Version 98.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Caspase-10 Short name=CASP-10 EC=3.4.22.63 Alternative name(s): ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 Short name=FLICE2 Cleaved into the following 2 chains: 1- Recommended name: Caspase-10 subunit p23/17 2- Recommended name: Caspase-10 subunit p12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 521 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC. Isoform C is proteolytically inactive. |
| Catalytic activity | Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly. |
| Subunit structure | Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit By similarity. Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. |
| Tissue specificity | Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon. |
| Post-translational modification | Cleavage by granzyme B and autocatalytic activity generate the two active subunits. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | Defects in CASP10 are the cause of autoimmune lymphoproliferative syndrome type 2A (ALPS2A) [MIM:603909]. ALPS2 is characterized by abnormal lymphocyte and dendritic cell homeostasis and immune regulatory defects. Defects in CASP10 are a cause of familial non-Hodgkin lymphoma (NHL) [MIM:605027]. NHL is a cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss. Defects in CASP10 are a cause of gastric cancers [MIM:137215]. |
| Sequence similarities | Belongs to the peptidase C14 family. Contains 2 DED (death effector) domains. |
Ontologies
Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Phosphoprotein Zymogen |
| Technical term | Direct protein sequencing |
Gene Ontology (GO) | |
| Biological process | induction of apoptosis by extracellular signals Inferred from Experiment. Source: Reactome proteolysisInferred from electronic annotation. Source: InterPro |
| Molecular function | cysteine-type endopeptidase activity Ref.1 Ref.9 Traceable author statement. Source: ProtInc identical protein binding Ref.6Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 1 | EBI-495095,EBI-495095 | ||
| itself | 1 | EBI-495122,EBI-495122 | ||
| CASP8 | Q14790 | 2 | EBI-495095,EBI-78060 | |
| EDA2R | Q9HAV5 | 1 | EBI-495122,EBI-526033 | |
| FADD | Q13158 | 1 | EBI-495095,EBI-494804 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q92851-1) Also known as: 10-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q92851-2) Also known as: 10-B; 10-S; The sequence of this isoform differs from the canonical sequence as follows: 229-271: Missing. 473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSI | ||||||
| Notes: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform D (identifier: Q92851-4) Also known as: 10-D; 10-L; The sequence of this isoform differs from the canonical sequence as follows: 473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSI | ||||||
| Isoform C (identifier: Q92851-3) Also known as: 10-C; The sequence of this isoform differs from the canonical sequence as follows: 241-273: GNRATNGAPSLVSRGMQGASANTLNSETSTKRA → EGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP 274-521: Missing. | ||||||
| Notes: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 219 | 219 | PRO_0000004644 | ||||||
| Chain | 220 – 415 | 196 | Caspase-10 subunit p23/17 | PRO_0000004645 | |||||
| Chain | 416 – 521 | 106 | Caspase-10 subunit p12 | PRO_0000004646 | |||||
Regions | |||||||||
| Domain | 19 – 97 | 79 | DED 1 | ||||||
| Domain | 114 – 187 | 74 | DED 2 | ||||||
Sites | |||||||||
| Active site | 358 | 1 | By similarity | ||||||
| Active site | 401 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 216 | 1 | Phosphoserine | ||||||
Natural variations | |||||||||
| Alternative sequence | 229 – 271 | 43 | Missing in isoform B. | VSP_000819 | |||||
| Alternative sequence | 241 – 273 | 33 | GNRAT…STKRA → EGSCVQDESEPQRPLCHCQQ PQLYLPEGQTRNP in isoform C. | VSP_000821 | |||||
| Alternative sequence | 274 – 521 | 248 | Missing in isoform C. | VSP_000822 | |||||
| Alternative sequence | 473 – 521 | 49 | MLKFL…WSSVS → HEDILSILTAVNDDVSRRVD KQGTKKQMPQPAFTLRKKLV FPVPLDALSI in isoform B and isoform D. | VSP_000820 | |||||
| Natural variant | 147 | 1 | M → T in gastric cancer; somatic mutation; impairs CASP10-mediated apoptosis. | VAR_037428 | |||||
| Natural variant | 285 | 1 | L → F in ALPS2A. dbSNP rs17860403. | VAR_014071 | |||||
| Natural variant | 406 | 1 | I → L in ALPS2A; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. | VAR_037429 | |||||
| Natural variant | 410 | 1 | V → I: dbSNP rs13010627. | VAR_014072 | |||||
| Natural variant | 414 | 1 | A → V in NHL; somatic mutation. dbSNP rs28936699. | VAR_037430 | |||||
| Natural variant | 446 | 1 | Y → C: dbSNP rs17860405. | VAR_037431 | |||||
Experimental info | |||||||||
| Mutagenesis | 401 | 1 | C → A: Abolishes proteolytic activity | ||||||
| Sequence conflict | 68 | 1 | E → G in AAB46730. Ref.2 | ||||||
| Sequence conflict | 268 | 1 | T → A in AAD28403. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "In vitro activation of CPP32 and Mch3 by Mch4, a novel human apoptotic cysteine protease containing two FADD-like domains." Fernandes-Alnemri T., Armstrong R.C., Krebs J.F., Srinivasula S.M., Wang L., Bullrich F., Fritz L.C., Trapani J.A., Tomaselli K.J., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:7464-7469(1996) [PubMed: 8755496] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Tissue: T-cell. |
| [2] | "Fas-associated death domain protein interleukin-1beta-converting enzyme 2 (FLICE2), an ICE/Ced-3 homologue, is proximally involved in CD95- and p55-mediated death signaling." Vincenz C., Dixit V.M. J. Biol. Chem. 272:6578-6583(1997) [PubMed: 9045686] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [3] | "Molecular cloning and characterization of two novel pro-apoptotic isoforms of caspase-10." Ng P.W., Porter A.G., Janicke R.U. J. Biol. Chem. 274:10301-10308(1999) [PubMed: 10187817] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C AND D), VARIANT ILE-410. Tissue: Spleen and Thymus. |
| [4] | "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2." Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J., Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A., Ikeda J.-E., Hayden M.R. Genomics 71:200-213(2001) [PubMed: 11161814] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS A AND B). |
| [5] | "Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases." Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:14486-14491(1996) [PubMed: 8962078] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, PROTEOLYTIC PROCESSING. |
| [6] | "Caspase-10 is an initiator caspase in death receptor signaling." Wang J., Chun H.J., Wong W., Spencer D.M., Lenardo M.J. Proc. Natl. Acad. Sci. U.S.A. 98:13884-13888(2001) [PubMed: 11717445] [Abstract] Cited for: FUNCTION, SELF-ASSOCIATION, INTERACTION WITH FADD, INTERACTION WITH CASP8, IDENTIFICATION IN A COMPLEX WITH FAS; FADD AND CASP8, MUTAGENESIS OF CYS-401. |
| [7] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [8] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-216, MASS SPECTROMETRY. |
| [9] | "Inherited human caspase 10 mutations underlie defective lymphocyte and dendritic cell apoptosis in autoimmune lymphoproliferative syndrome type II." Wang J., Zheng L., Lobito A., Chan F.K., Dale J., Sneller M., Yao X., Puck J.M., Straus S.E., Lenardo M.J. Cell 98:47-58(1999) [PubMed: 10412980] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS B AND D), VARIANT ALPS2A PHE-285, VARIANT ILE-410. |
| [10] | "Inactivating mutations of CASP10 gene in non-Hodgkin lymphomas." Shin M.S., Kim H.S., Kang C.S., Park W.S., Kim S.Y., Lee S.N., Lee J.H., Park J.Y., Jang J.J., Kim C.W., Kim S.H., Lee J.Y., Yoo N.J., Lee S.H. Blood 99:4094-4099(2002) [PubMed: 12010812] [Abstract] Cited for: VARIANT NHL VAL-414. |
| [11] | "Inactivating mutations of the caspase-10 gene in gastric cancer." Park W.S., Lee J.H., Shin M.S., Park J.Y., Kim H.S., Lee J.H., Kim Y.S., Lee S.N., Xiao W., Park C.H., Lee S.H., Yoo N.J., Lee J.Y. Oncogene 21:2919-2925(2002) [PubMed: 11973654] [Abstract] Cited for: VARIANT GASTRIC CANCER THR-147, CHARACTERIZATION OF VARIANT GASTRIC CANCER THR-147. |
| [12] | "Genetic alterations in caspase-10 may be causative or protective in autoimmune lymphoproliferative syndrome." Zhu S., Hsu A.P., Vacek M.M., Zheng L., Schaeffer A.A., Dale J.K., Davis J., Fischer R.E., Straus S.E., Boruchov D., Saulsbury F.T., Lenardo M.J., Puck J.M. Hum. Genet. 119:284-294(2006) [PubMed: 16446975] [Abstract] Cited for: VARIANT ALPS2A LEU-406, CHARACTERIZATION OF VARIANT ALPS2A LEU-406. |
| + | Additional computationally mapped references. |
Web resources
| CASP10base CASP10 mutation db |
| Autoimmune Lymphoproliferative Syndrome Database (ALPSbase) Caspase-10 mutations causing ALPS type II |
| GeneReviews |
Cross-references
Sequence databases | |
|---|---|
| U60519 mRNA. Translation: AAC50644.1. U86214 mRNA. Translation: AAB46730.1. AF111344 mRNA. Translation: AAD28402.1. AF111345 mRNA. Translation: AAD28403.1. AB038979 Genomic DNA. Translation: BAB32553.1. AB038979 Genomic DNA. Translation: BAB32554.1. | |
| RefSeq | NP_001221.2. NP_116756.2. |
| UniGene | Hs.5353 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QTN based on UniProtKB Q9C0K4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q92851. |
Protein family/group databases | |
| MEROPS | C14.011. |
PTM databases | |
| PhosphoSite | Q92851. |
Genome annotation databases | |
| Ensembl | ENSG00000003400. Homo sapiens. [Contig view] |
| GeneID | 843. |
| KEGG | hsa:843. |
Organism-specific databases | |
| HGNC | HGNC:1500. CASP10. |
| HPA | CAB003780. HPA017059. |
| MIM | 137215. phenotype. 601762. gene. 603909. phenotype. 605027. phenotype. |
| Orphanet | 3261. Autoimmune lymphoproliferative syndrome. 26106. Gastric cancer, familial. |
| PharmGKB | PA26084. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | Q92851. |
Enzyme and pathway databases | |
| Reactome | REACT_578. Apoptosis. |
Gene expression databases | |
| ArrayExpress | Q92851. |
| CleanEx | HS_CASP10. |
| GermOnline | ENSG00000003400. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011029. DEATH_like. IPR001875. DED. IPR011600. Pept_C14_cat. IPR001309. Pept_C14_ICE_p20. IPR016129. Pept_C14_ICE_p20_AS. IPR002138. Pept_C14_p10. IPR002398. Pept_C14_p45. IPR015917. Pept_C14_p45_core. [Graphical view] |
| Gene3D | G3DSA:1.10.533.10. DEATH_like. 2 hits. |
| PANTHER | PTHR10454. Pept_C14_p45. 1 hit. |
| Pfam | PF01335. DED. 2 hits. PF00656. Peptidase_C14. 1 hit. [Graphical view] |
| PRINTS | PR00376. IL1BCENZYME. |
| SMART | SM00115. CASc. 1 hit. SM00031. DED. 2 hits. [Graphical view] |
| PROSITE | PS01122. CASPASE_CYS. 1 hit. PS01121. CASPASE_HIS. 1 hit. PS50207. CASPASE_P10. 1 hit. PS50208. CASPASE_P20. 1 hit. PS50168. DED. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 3530. |
| SOURCE | Search... |
Entry information
| Entry name | CASPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92851 Secondary accession number(s): Q8WYQ8 Q9Y2U7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


