Q92851 (CASPA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 144.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Caspase-10 Short name=CASP-10 EC=3.4.22.63 Alternative name(s): Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 Short name=FLICE2 ICE-like apoptotic protease 4 Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 521 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC. Ref.11 |
| Catalytic activity | Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly. |
| Subunit structure | Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit By similarity. Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Ref.11 |
| Tissue specificity | Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon. |
| Post-translational modification | Cleavage by granzyme B and autocatalytic activity generate the two active subunits. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | Autoimmune lymphoproliferative syndrome 2A (ALPS2A) [MIM:603909]: A disorder of apoptosis that manifests in early childhood and results in the accumulation of autoreactive lymphocytes. It is characterized by non-malignant lymphadenopathy with hepatosplenomegaly, and autoimmune hemolytic anemia, thrombocytopenia and neutropenia. Familial non-Hodgkin lymphoma (NHL) [MIM:605027]: Cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss. Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease. |
| Sequence similarities | Belongs to the peptidase C14A family. Contains 2 DED (death effector) domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Phosphoprotein Zymogen |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Traceable author statement. Source: Reactome induction of apoptosisTraceable author statement Ref.13. Source: ProtInc innate immune responseTraceable author statement. Source: Reactome positive regulation of I-kappaB kinase/NF-kappaB cascadeInferred from mutant phenotype PubMed 12884866. Source: UniProtKB proteolysisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytosol Traceable author statement. Source: Reactome plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | cysteine-type endopeptidase activity Traceable author statement Ref.13Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CASP8 | Q14790 | 5 | EBI-495095,EBI-78060 | |
| RIOK3 | O14730 | 4 | EBI-495095,EBI-1047061 | |
| RIPK1 | Q13546 | 2 | EBI-495095,EBI-358507 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q92851-1) Also known as: 10-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q92851-2) Also known as: 10-B; 10-S; The sequence of this isoform differs from the canonical sequence as follows: 229-271: Missing. 473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform D (identifier: Q92851-4) Also known as: 10-D; 10-L; The sequence of this isoform differs from the canonical sequence as follows: 473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL | ||||||
| Isoform C (identifier: Q92851-3) Also known as: 10-C; The sequence of this isoform differs from the canonical sequence as follows: 241-273: GNRATNGAPSLVSRGMQGASANTLNSETSTKRA → EGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP 274-521: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 5 (identifier: Q92851-5) The sequence of this isoform differs from the canonical sequence as follows: 229-271: Missing. | ||||||
| Isoform 6 (identifier: Q92851-6) The sequence of this isoform differs from the canonical sequence as follows: 241-307: Missing. 473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 219 | 219 | PRO_0000004644 | ||||||
| Chain | 220 – 415 | 196 | Caspase-10 subunit p23/17 | PRO_0000004645 | |||||
| Chain | 416 – 521 | 106 | Caspase-10 subunit p12 | PRO_0000004646 | |||||
Regions | |||||||||
| Domain | 19 – 97 | 79 | DED 1 | ||||||
| Domain | 114 – 187 | 74 | DED 2 | ||||||
Sites | |||||||||
| Active site | 358 | 1 | By similarity | ||||||
| Active site | 401 | 1 | By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 229 – 271 | 43 | Missing in isoform B and isoform 5. | VSP_000819 | |||||
| Alternative sequence | 241 – 307 | 67 | Missing in isoform 6. | VSP_037229 | |||||
| Alternative sequence | 241 – 273 | 33 | GNRAT…STKRA → EGSCVQDESEPQRPLCHCQQ PQLYLPEGQTRNP in isoform C. | VSP_000821 | |||||
| Alternative sequence | 274 – 521 | 248 | Missing in isoform C. | VSP_000822 | |||||
| Alternative sequence | 473 – 521 | 49 | MLKFL…WSSVS → HEDILSILTAVNDDVSRRVD KQGTKKQMPQPAFTLRKKLV FPVPLDALSL in isoform B, isoform D and isoform 6. | VSP_000820 | |||||
| Natural variant | 14 | 1 | K → T Found in a colon cancer sample; somatic mutation. Ref.19 | VAR_065233 | |||||
| Natural variant | 21 | 1 | R → C Found in a multiple myeloma sample; somatic mutation. Ref.18 | VAR_065234 | |||||
| Natural variant | 147 | 1 | M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. Ref.15 | VAR_037428 | |||||
| Natural variant | 239 | 1 | S → C. Ref.6 Corresponds to variant rs41473647 [ dbSNP | Ensembl ]. | VAR_055361 | |||||
| Natural variant | 285 | 1 | L → F in ALPS2A. Ref.13 Corresponds to variant rs17860403 [ dbSNP | Ensembl ]. | VAR_014071 | |||||
| Natural variant | 285 | 1 | L → P Found in a T-acute lymphoblastic leukemia sample; somatic mutation. Ref.18 | VAR_065235 | |||||
| Natural variant | 406 | 1 | I → L in ALPS2A; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. Ref.16 | VAR_037429 | |||||
| Natural variant | 410 | 1 | V → I Does not interfere with apoptosis in a dominant negative manner. Ref.3 Ref.6 Ref.13 Ref.16 Corresponds to variant rs13010627 [ dbSNP | Ensembl ]. | VAR_014072 | |||||
| Natural variant | 414 | 1 | A → V in NHL; somatic mutation. Ref.14 Corresponds to variant rs28936699 [ dbSNP | Ensembl ]. | VAR_037430 | |||||
| Natural variant | 444 | 1 | P → S. Ref.6 Corresponds to variant rs41513147 [ dbSNP | Ensembl ]. | VAR_055362 | |||||
| Natural variant | 446 | 1 | Y → C Associated with ALPS2A; does not interfere with apoptosis in a dominant negative manner. Ref.6 Ref.16 Corresponds to variant rs17860405 [ dbSNP | Ensembl ]. | VAR_037431 | |||||
| Isoform B: | |||||||||
| Natural variant | 479 | 1 | L → I. Corresponds to variant rs13006529 [ dbSNP | Ensembl ]. | ||||||
| Isoform D: | |||||||||
| Natural variant | 522 | 1 | L → I Not associated with significantly altered cutaneous melanoma risk. Corresponds to variant rs13006529 [ dbSNP | Ensembl ]. | ||||||
| Isoform 6: | |||||||||
| Natural variant | 455 | 1 | L → I. Corresponds to variant rs13006529 [ dbSNP | Ensembl ]. | ||||||
Experimental info | |||||||||
| Mutagenesis | 401 | 1 | C → A: Abolishes proteolytic activity. Ref.11 | ||||||
| Sequence conflict | 68 | 1 | E → G in AAB46730. Ref.2 | ||||||
| Sequence conflict | 268 | 1 | T → A in AAD28403. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "In vitro activation of CPP32 and Mch3 by Mch4, a novel human apoptotic cysteine protease containing two FADD-like domains." Fernandes-Alnemri T., Armstrong R.C., Krebs J.F., Srinivasula S.M., Wang L., Bullrich F., Fritz L.C., Trapani J.A., Tomaselli K.J., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:7464-7469(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), VARIANT ILE-479 (ISOFORM B). Tissue: T-cell. |
| [2] | "Fas-associated death domain protein interleukin-1beta-converting enzyme 2 (FLICE2), an ICE/Ced-3 homologue, is proximally involved in CD95- and p55-mediated death signaling." Vincenz C., Dixit V.M. J. Biol. Chem. 272:6578-6583(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [3] | "Molecular cloning and characterization of two novel pro-apoptotic isoforms of caspase-10." Ng P.W., Porter A.G., Janicke R.U. J. Biol. Chem. 274:10301-10308(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C AND D), VARIANT ILE-410, VARIANT ILE-522 (ISOFORM D). Tissue: Spleen and Thymus. |
| [4] | "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2." Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J., Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A., Ikeda J.-E., Hayden M.R. Genomics 71:200-213(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS A AND B), VARIANT ILE-479 (ISOFORM B). |
| [5] | "A novel human caspase 10 isoform participating in Fas-induced apoptosis." Vonarbourg C., Fischer A., Rieux-Laucat F. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), VARIANT ILE-455 (ISOFORM 6). Tissue: Blood. |
| [6] | NIEHS SNPs program Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-239; ILE-410; SER-444; CYS-446 AND ILE-522 (ISOFORM 2). |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D). Tissue: Brain. |
| [10] | "Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases." Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:14486-14491(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, PROTEOLYTIC PROCESSING. |
| [11] | "Caspase-10 is an initiator caspase in death receptor signaling." Wang J., Chun H.J., Wong W., Spencer D.M., Lenardo M.J. Proc. Natl. Acad. Sci. U.S.A. 98:13884-13888(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SELF-ASSOCIATION, INTERACTION WITH FADD, INTERACTION WITH CASP8, IDENTIFICATION IN A COMPLEX WITH FAS; FADD AND CASP8, MUTAGENESIS OF CYS-401. |
| [12] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [13] | "Inherited human caspase 10 mutations underlie defective lymphocyte and dendritic cell apoptosis in autoimmune lymphoproliferative syndrome type II." Wang J., Zheng L., Lobito A., Chan F.K., Dale J., Sneller M., Yao X., Puck J.M., Straus S.E., Lenardo M.J. Cell 98:47-58(1999) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS B AND D), VARIANT ALPS2A PHE-285, VARIANT ILE-410. |
| [14] | "Inactivating mutations of CASP10 gene in non-Hodgkin lymphomas." Shin M.S., Kim H.S., Kang C.S., Park W.S., Kim S.Y., Lee S.N., Lee J.H., Park J.Y., Jang J.J., Kim C.W., Kim S.H., Lee J.Y., Yoo N.J., Lee S.H. Blood 99:4094-4099(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NHL VAL-414. |
| [15] | "Inactivating mutations of the caspase-10 gene in gastric cancer." Park W.S., Lee J.H., Shin M.S., Park J.Y., Kim H.S., Lee J.H., Kim Y.S., Lee S.N., Xiao W., Park C.H., Lee S.H., Yoo N.J., Lee J.Y. Oncogene 21:2919-2925(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GASC THR-147, CHARACTERIZATION OF VARIANT GASC THR-147. |
| [16] | "Genetic alterations in caspase-10 may be causative or protective in autoimmune lymphoproliferative syndrome." Zhu S., Hsu A.P., Vacek M.M., Zheng L., Schaeffer A.A., Dale J.K., Davis J., Fischer R.E., Straus S.E., Boruchov D., Saulsbury F.T., Lenardo M.J., Puck J.M. Hum. Genet. 119:284-294(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ALPS2A LEU-406, VARIANTS ILE-410 AND CYS-446, CHARACTERIZATION OF VARIANTS ALPS2A LEU-406, CHARACTERIZATION OF VARIANTS ILE-410 AND CYS-446. |
| [17] | "Genetic variants and haplotypes of the caspase-8 and caspase-10 genes contribute to susceptibility to cutaneous melanoma." Li C., Zhao H., Hu Z., Liu Z., Wang L.-E., Gershenwald J.E., Prieto V.G., Lee J.E., Duvic M., Grimm E.A., Wei Q. Hum. Mutat. 29:1443-1451(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ILE-522 (ISOFORM D), RISK FACTOR FOR CUTANEOUS MELANOMA. |
| [18] | "Mutational analysis of CASP10 gene in acute leukaemias and multiple myelomas." Kim M.S., Oh J.E., Min C.K., Lee S., Chung N.G., Yoo N.J., Lee S.H. Pathology 41:484-487(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CYS-21 AND PRO-285. |
| [19] | "Mutational analysis of CASP10 gene in colon, breast, lung and hepatocellular carcinomas." Oh J.E., Kim M.S., Ahn C.H., Kim S.S., Han J.Y., Lee S.H., Yoo N.J. Pathology 42:73-76(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT THR-14. |
| + | Additional computationally mapped references. |
Web resources
| CASP10base CASP10 mutation db |
| Autoimmune Lymphoproliferative Syndrome Database (ALPSbase) Caspase-10 mutations causing ALPS type II |
| GeneReviews |
| NIEHS-SNPs |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U60519 mRNA. Translation: AAC50644.1. U86214 mRNA. Translation: AAB46730.1. AF111344 mRNA. Translation: AAD28402.1. AF111345 mRNA. Translation: AAD28403.1. AB038979 Genomic DNA. Translation: BAB32553.1. AB038979 Genomic DNA. Translation: BAB32554.1. AJ487678 mRNA. Translation: CAD32371.1. AJ487679 mRNA. Translation: CAD32372.1. EF050529 Genomic DNA. Translation: ABJ53426.1. AC007283 Genomic DNA. Translation: AAY24291.1. CH471063 Genomic DNA. Translation: EAW70248.1. CH471063 Genomic DNA. Translation: EAW70249.1. BC042844 mRNA. Translation: AAH42844.1. |
| IPI | IPI00216197. IPI00290791. IPI00334756. IPI00433086. IPI00433087. IPI00868860. |
| RefSeq | NP_001193453.1. NM_001206524.1. NP_001193471.1. NM_001206542.1. NP_001221.2. NM_001230.4. NP_116756.2. NM_032974.4. NP_116758.1. NM_032976.3. NP_116759.2. NM_032977.3. |
| UniGene | Hs.5353. |
3D structure databases | |
| ProteinModelPortal | Q92851. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q92851. 18 interactions. |
| MINT | MINT-201954. |
| STRING | 9606.ENSP00000286186. |
Protein family/group databases | |
| MEROPS | C14.011. |
PTM databases | |
| PhosphoSite | Q92851. |
Polymorphism databases | |
| DMDM | 12644463. |
Proteomic databases | |
| PaxDb | Q92851. |
| PRIDE | Q92851. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000272879; ENSP00000272879; ENSG00000003400. ENST00000286186; ENSP00000286186; ENSG00000003400. ENST00000313728; ENSP00000314599; ENSG00000003400. ENST00000346817; ENSP00000237865; ENSG00000003400. ENST00000360132; ENSP00000353250; ENSG00000003400. ENST00000448480; ENSP00000396835; ENSG00000003400. |
| GeneID | 843. |
| KEGG | hsa:843. |
| UCSC | uc002uxj.1. human. uc002uxk.1. human. uc002uxl.2. human. uc002uxm.2. human. uc010fta.1. human. uc010ftb.2. human. |
Organism-specific databases | |
| CTD | 843. |
| GeneCards | GC02P202047. |
| HGNC | HGNC:1500. CASP10. |
| HPA | CAB003780. HPA017059. |
| MIM | 601762. gene. 603909. phenotype. 605027. phenotype. 613659. phenotype. |
| neXtProt | NX_Q92851. |
| Orphanet | 3261. Autoimmune lymphoproliferative syndrome. |
| PharmGKB | PA26084. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG303276. |
| HOVERGEN | HBG050803. |
| KO | K04400. |
| OMA | QGTKKQM. |
Enzyme and pathway databases | |
| BRENDA | 3.4.22.63. 2681. |
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. faspathway. FAS signaling pathway (CD95). trail_pathway. TRAIL signaling pathway. |
| Reactome | REACT_578. Apoptosis. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q92851. |
| Bgee | Q92851. |
| CleanEx | HS_CASP10. |
| Genevestigator | Q92851. |
| GermOnline | ENSG00000003400. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.533.10. 2 hits. |
| InterPro | IPR011029. DEATH-like_dom. IPR001875. DED. IPR011600. Pept_C14_cat. IPR001309. Pept_C14_ICE_p20. IPR016129. Pept_C14_ICE_p20_AS. IPR002138. Pept_C14_p10. IPR002398. Pept_C14_p45. IPR015917. Pept_C14_p45_core. [Graphical view] |
| PANTHER | PTHR10454. PTHR10454. 1 hit. |
| Pfam | PF01335. DED. 2 hits. PF00656. Peptidase_C14. 1 hit. [Graphical view] |
| PRINTS | PR00376. IL1BCENZYME. |
| SMART | SM00115. CASc. 1 hit. SM00031. DED. 2 hits. [Graphical view] |
| SUPFAM | SSF47986. DEATH_like. 2 hits. |
| PROSITE | PS01122. CASPASE_CYS. 1 hit. PS01121. CASPASE_HIS. 1 hit. PS50207. CASPASE_P10. 1 hit. PS50208. CASPASE_P20. 1 hit. PS50168. DED. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q92851. |
| ChEMBL | CHEMBL5037. |
| ChiTaRS | CASP10. human. |
| GenomeRNAi | 843. |
| NextBio | 3530. |
| PMAP-CutDB | Q8IUP5. |
| SOURCE | Search... |
Entry information
| Entry name | CASPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92851 Secondary accession number(s): Q6KF62 Q9Y2U7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
