SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92851

- CASPA_HUMAN

UniProt

Q92851 - CASPA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Caspase-10

Gene
CASP10, MCH4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC.1 Publication
Isoform C is proteolytically inactive.1 Publication

Catalytic activityi

Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly.

Enzyme regulationi

Negatively regulated by RFFL through proteasomal degradation.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei358 – 3581
Active sitei401 – 4011

GO - Molecular functioni

  1. cysteine-type endopeptidase activity Source: ProtInc
  2. cysteine-type endopeptidase activity involved in apoptotic signaling pathway Source: UniProtKB
  3. death effector domain binding Source: UniProtKB
  4. protein binding Source: IntAct
  5. ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process Source: RefGenome
  2. apoptotic signaling pathway Source: Reactome
  3. innate immune response Source: Reactome
  4. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  5. regulation of apoptotic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BRENDAi3.4.22.63. 2681.
ReactomeiREACT_25039. NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10.
REACT_402. TRAIL signaling.
REACT_900. FasL/ CD95L signaling.

Protein family/group databases

MEROPSiC14.011.

Names & Taxonomyi

Protein namesi
Recommended name:
Caspase-10 (EC:3.4.22.63)
Short name:
CASP-10
Alternative name(s):
Apoptotic protease Mch-4
FAS-associated death domain protein interleukin-1B-converting enzyme 2
Short name:
FLICE2
ICE-like apoptotic protease 4
Cleaved into the following 2 chains:
Gene namesi
Name:CASP10
Synonyms:MCH4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Organism-specific databases

HGNCiHGNC:1500. CASP10.

Subcellular locationi

GO - Cellular componenti

  1. CD95 death-inducing signaling complex Source: UniProtKB
  2. cytoplasm Source: RefGenome
  3. cytosol Source: Reactome
  4. plasma membrane Source: Reactome
  5. ripoptosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Autoimmune lymphoproliferative syndrome 2A (ALPS2A) [MIM:603909]: A disorder of apoptosis that manifests in early childhood and results in the accumulation of autoreactive lymphocytes. It is characterized by non-malignant lymphadenopathy with hepatosplenomegaly, and autoimmune hemolytic anemia, thrombocytopenia and neutropenia.2 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti285 – 2851L → F in ALPS2A. 1 Publication
Corresponds to variant rs17860403 [ dbSNP | Ensembl ].
VAR_014071
Natural varianti406 – 4061I → L in ALPS2A; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. 1 Publication
Corresponds to variant rs80358239 [ dbSNP | Ensembl ].
VAR_037429
Natural varianti446 – 4461Y → C Associated with ALPS2A; does not interfere with apoptosis in a dominant negative manner. 1 Publication
Corresponds to variant rs17860405 [ dbSNP | Ensembl ].
VAR_037431
Familial non-Hodgkin lymphoma (NHL) [MIM:605027]: Cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss.1 Publication
Note: The gene represented in this entry is involved in disease pathogenesis.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti414 – 4141A → V in NHL; somatic mutation. 1 Publication
Corresponds to variant rs28936699 [ dbSNP | Ensembl ].
VAR_037430
Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.1 Publication
Note: The gene represented in this entry is involved in disease pathogenesis.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti147 – 1471M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 Publication
Corresponds to variant rs121909776 [ dbSNP | Ensembl ].
VAR_037428

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi401 – 4011C → A: Abolishes proteolytic activity. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi603909. phenotype.
605027. phenotype.
613659. phenotype.
Orphaneti3261. Autoimmune lymphoproliferative syndrome.
PharmGKBiPA26084.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei1 – 219219PRO_0000004644Add
BLAST
Chaini220 – 415196Caspase-10 subunit p23/17PRO_0000004645Add
BLAST
Chaini416 – 521106Caspase-10 subunit p12PRO_0000004646Add
BLAST

Post-translational modificationi

Cleavage by granzyme B and autocatalytic activity generate the two active subunits.

Keywords - PTMi

Zymogen

Proteomic databases

MaxQBiQ92851.
PaxDbiQ92851.
PRIDEiQ92851.

PTM databases

PhosphoSiteiQ92851.

Miscellaneous databases

PMAP-CutDBQ8IUP5.

Expressioni

Tissue specificityi

Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon.

Gene expression databases

ArrayExpressiQ92851.
BgeeiQ92851.
CleanExiHS_CASP10.
GenevestigatoriQ92851.

Organism-specific databases

HPAiCAB003780.
HPA017059.

Interactioni

Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit By similarity. Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Interacts with RFFL.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CASP8Q147903EBI-495095,EBI-78060
CFLARO155193EBI-495095,EBI-514941
RIOK3O147304EBI-495095,EBI-1047061
RIPK1Q135462EBI-495095,EBI-358507

Protein-protein interaction databases

BioGridi107293. 88 interactions.
IntActiQ92851. 21 interactions.
MINTiMINT-201954.
STRINGi9606.ENSP00000286186.

Structurei

3D structure databases

ProteinModelPortaliQ92851.
SMRiQ92851. Positions 273-499.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 9779DED 1PROSITE-ProRule annotationsAdd
BLAST
Domaini114 – 18774DED 2PROSITE-ProRule annotationsAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C14A family.
Contains 2 DED (death effector) domains.PROSITE-ProRule annotations

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG303276.
HOVERGENiHBG050803.
KOiK04400.
OMAiEANIEKW.
OrthoDBiEOG7CRTQM.
PhylomeDBiQ92851.
TreeFamiTF102023.

Family and domain databases

Gene3Di1.10.533.10. 2 hits.
3.40.50.1460. 1 hit.
InterProiIPR029030. Caspase-like_dom.
IPR011029. DEATH-like_dom.
IPR001875. DED.
IPR011600. Pept_C14_caspase.
IPR001309. Pept_C14_ICE_p20.
IPR016129. Pept_C14_ICE_p20_AS.
IPR002138. Pept_C14_p10.
IPR015917. Pept_C14A_p45_core.
[Graphical view]
PfamiPF01335. DED. 2 hits.
PF00656. Peptidase_C14. 1 hit.
[Graphical view]
PRINTSiPR00376. IL1BCENZYME.
SMARTiSM00115. CASc. 1 hit.
SM00031. DED. 2 hits.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 2 hits.
PROSITEiPS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
PS50168. DED. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q92851-1) [UniParc]FASTAAdd to Basket

Also known as: 10-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKSQGQHWYS SSDKNCKVSF REKLLIIDSN LGVQDVENLK FLCIGLVPNK    50
KLEKSSSASD VFEHLLAEDL LSEEDPFFLA ELLYIIRQKK LLQHLNCTKE 100
EVERLLPTRQ RVSLFRNLLY ELSEGIDSEN LKDMIFLLKD SLPKTEMTSL 150
SFLAFLEKQG KIDEDNLTCL EDLCKTVVPK LLRNIEKYKR EKAIQIVTPP 200
VDKEAESYQG EEELVSQTDV KTFLEALPQE SWQNKHAGSN GNRATNGAPS 250
LVSRGMQGAS ANTLNSETST KRAAVYRMNR NHRGLCVIVN NHSFTSLKDR 300
QGTHKDAEIL SHVFQWLGFT VHIHNNVTKV EMEMVLQKQK CNPAHADGDC 350
FVFCILTHGR FGAVYSSDEA LIPIREIMSH FTALQCPRLA EKPKLFFIQA 400
CQGEEIQPSV SIEADALNPE QAPTSLQDSI PAEADFLLGL ATVPGYVSFR 450
HVEEGSWYIQ SLCNHLKKLV PRMLKFLEKT MEIRGRKRTV WGAKQISATS 500
LPTAISAQTP RPPMRRWSSV S 521
Length:521
Mass (Da):58,951
Last modified:January 11, 2001 - v3
Checksum:i840348AE602B8243
GO
Isoform B (identifier: Q92851-2) [UniParc]FASTAAdd to Basket

Also known as: 10-B, 10-S

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:479
Mass (Da):54,566
Checksum:i1467FD7A4EE003FF
GO
Isoform D (identifier: Q92851-4) [UniParc]FASTAAdd to Basket

Also known as: 10-D, 10-L

The sequence of this isoform differs from the canonical sequence as follows:
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:522
Mass (Da):58,994
Checksum:i34847E07B3DFA688
GO
Isoform C (identifier: Q92851-3) [UniParc]FASTAAdd to Basket

Also known as: 10-C

The sequence of this isoform differs from the canonical sequence as follows:
     241-273: GNRATNGAPSLVSRGMQGASANTLNSETSTKRA → EGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP
     274-521: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:273
Mass (Da):31,419
Checksum:i1146630514EE38DC
GO
Isoform 5 (identifier: Q92851-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.

Show »
Length:478
Mass (Da):54,523
Checksum:iE78035535F8EF57B
GO
Isoform 6 (identifier: Q92851-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-307: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:455
Mass (Da):51,785
Checksum:i89037FC3EC173616
GO
Isoform 7 (identifier: Q92851-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-247: QESWQNKHAGSNGNRATNG → EGVFVFLNEGDRGNSPDDL
     248-521: Missing.

Show »
Length:247
Mass (Da):28,364
Checksum:i52370B5AD12C4DCF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141K → T Found in a colon cancer sample; somatic mutation. 1 Publication
VAR_065233
Natural varianti21 – 211R → C Found in a multiple myeloma sample; somatic mutation. 1 Publication
VAR_065234
Natural varianti147 – 1471M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 Publication
Corresponds to variant rs121909776 [ dbSNP | Ensembl ].
VAR_037428
Natural varianti239 – 2391S → C.
Corresponds to variant rs41473647 [ dbSNP | Ensembl ].
VAR_055361
Natural varianti285 – 2851L → F in ALPS2A. 1 Publication
Corresponds to variant rs17860403 [ dbSNP | Ensembl ].
VAR_014071
Natural varianti285 – 2851L → P Found in a T-acute lymphoblastic leukemia sample; somatic mutation. 1 Publication
VAR_065235
Natural varianti406 – 4061I → L in ALPS2A; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. 1 Publication
Corresponds to variant rs80358239 [ dbSNP | Ensembl ].
VAR_037429
Natural varianti410 – 4101V → I Does not interfere with apoptosis in a dominant negative manner. 3 Publications
Corresponds to variant rs13010627 [ dbSNP | Ensembl ].
VAR_014072
Natural varianti414 – 4141A → V in NHL; somatic mutation. 1 Publication
Corresponds to variant rs28936699 [ dbSNP | Ensembl ].
VAR_037430
Natural varianti444 – 4441P → S.
Corresponds to variant rs41513147 [ dbSNP | Ensembl ].
VAR_055362
Natural varianti446 – 4461Y → C Associated with ALPS2A; does not interfere with apoptosis in a dominant negative manner. 1 Publication
Corresponds to variant rs17860405 [ dbSNP | Ensembl ].
VAR_037431
Isoform 6 (identifier: Q92851-6)
Natural varianti455 – 4551L → I.
Corresponds to variant rs13006529 [ dbSNP | Ensembl ].
Isoform B (identifier: Q92851-2)
Natural varianti479 – 4791L → I.
Corresponds to variant rs13006529 [ dbSNP | Ensembl ].
Isoform D (identifier: Q92851-4)
Natural varianti522 – 5221L → I Not associated with significantly altered cutaneous melanoma risk.
Corresponds to variant rs13006529 [ dbSNP | Ensembl ].

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei229 – 27143Missing in isoform B and isoform 5. 2 PublicationsVSP_000819Add
BLAST
Alternative sequencei229 – 24719QESWQ…RATNG → EGVFVFLNEGDRGNSPDDL in isoform 7. 1 PublicationVSP_053333Add
BLAST
Alternative sequencei241 – 30767Missing in isoform 6. 1 PublicationVSP_037229Add
BLAST
Alternative sequencei241 – 27333GNRAT…STKRA → EGSCVQDESEPQRPLCHCQQ PQLYLPEGQTRNP in isoform C. 1 PublicationVSP_000821Add
BLAST
Alternative sequencei248 – 521274Missing in isoform 7. 1 PublicationVSP_053334Add
BLAST
Alternative sequencei274 – 521248Missing in isoform C. 1 PublicationVSP_000822Add
BLAST
Alternative sequencei473 – 52149MLKFL…WSSVS → HEDILSILTAVNDDVSRRVD KQGTKKQMPQPAFTLRKKLV FPVPLDALSL in isoform B, isoform D and isoform 6. 4 PublicationsVSP_000820Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti68 – 681E → G in AAB46730. 1 Publication
Sequence conflicti268 – 2681T → A in AAD28403. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U60519 mRNA. Translation: AAC50644.1.
U86214 mRNA. Translation: AAB46730.1.
AF111344 mRNA. Translation: AAD28402.1.
AF111345 mRNA. Translation: AAD28403.1.
AB038979 Genomic DNA. Translation: BAB32553.1.
AB038979 Genomic DNA. Translation: BAB32554.1.
AJ487678 mRNA. Translation: CAD32371.1.
AJ487679 mRNA. Translation: CAD32372.1.
AY690601 mRNA. Translation: AAU00989.1.
EF050529 Genomic DNA. Translation: ABJ53426.1.
AC007283 Genomic DNA. Translation: AAY24291.1.
CH471063 Genomic DNA. Translation: EAW70248.1.
CH471063 Genomic DNA. Translation: EAW70249.1.
BC042844 mRNA. Translation: AAH42844.1.
CCDSiCCDS2338.1. [Q92851-1]
CCDS2339.1. [Q92851-2]
CCDS2340.1. [Q92851-4]
CCDS56159.1. [Q92851-6]
CCDS56160.1. [Q92851-5]
RefSeqiNP_001193453.1. NM_001206524.1. [Q92851-6]
NP_001193471.1. NM_001206542.1. [Q92851-5]
NP_001221.2. NM_001230.4. [Q92851-2]
NP_116756.2. NM_032974.4. [Q92851-1]
NP_116758.1. NM_032976.3. [Q92851-3]
NP_116759.2. NM_032977.3. [Q92851-4]
XP_005246967.1. XM_005246910.1. [Q92851-3]
XP_005246968.1. XM_005246911.1. [Q92851-7]
UniGeneiHs.5353.

Genome annotation databases

EnsembliENST00000272879; ENSP00000272879; ENSG00000003400. [Q92851-1]
ENST00000286186; ENSP00000286186; ENSG00000003400. [Q92851-4]
ENST00000313728; ENSP00000314599; ENSG00000003400. [Q92851-6]
ENST00000346817; ENSP00000237865; ENSG00000003400. [Q92851-2]
ENST00000360132; ENSP00000353250; ENSG00000003400. [Q92851-3]
ENST00000374650; ENSP00000363781; ENSG00000003400. [Q92851-7]
ENST00000448480; ENSP00000396835; ENSG00000003400. [Q92851-5]
GeneIDi843.
KEGGihsa:843.
UCSCiuc002uxj.1. human. [Q92851-4]
uc002uxk.1. human. [Q92851-2]
uc002uxl.2. human. [Q92851-1]
uc002uxm.2. human. [Q92851-5]
uc010fta.1. human. [Q92851-6]
uc010ftb.2. human. [Q92851-3]

Polymorphism databases

DMDMi12644463.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

CASP10base

CASP10 mutation db

Autoimmune Lymphoproliferative Syndrome Database (ALPSbase)

Caspase-10 mutations causing ALPS type II

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U60519 mRNA. Translation: AAC50644.1 .
U86214 mRNA. Translation: AAB46730.1 .
AF111344 mRNA. Translation: AAD28402.1 .
AF111345 mRNA. Translation: AAD28403.1 .
AB038979 Genomic DNA. Translation: BAB32553.1 .
AB038979 Genomic DNA. Translation: BAB32554.1 .
AJ487678 mRNA. Translation: CAD32371.1 .
AJ487679 mRNA. Translation: CAD32372.1 .
AY690601 mRNA. Translation: AAU00989.1 .
EF050529 Genomic DNA. Translation: ABJ53426.1 .
AC007283 Genomic DNA. Translation: AAY24291.1 .
CH471063 Genomic DNA. Translation: EAW70248.1 .
CH471063 Genomic DNA. Translation: EAW70249.1 .
BC042844 mRNA. Translation: AAH42844.1 .
CCDSi CCDS2338.1. [Q92851-1 ]
CCDS2339.1. [Q92851-2 ]
CCDS2340.1. [Q92851-4 ]
CCDS56159.1. [Q92851-6 ]
CCDS56160.1. [Q92851-5 ]
RefSeqi NP_001193453.1. NM_001206524.1. [Q92851-6 ]
NP_001193471.1. NM_001206542.1. [Q92851-5 ]
NP_001221.2. NM_001230.4. [Q92851-2 ]
NP_116756.2. NM_032974.4. [Q92851-1 ]
NP_116758.1. NM_032976.3. [Q92851-3 ]
NP_116759.2. NM_032977.3. [Q92851-4 ]
XP_005246967.1. XM_005246910.1. [Q92851-3 ]
XP_005246968.1. XM_005246911.1. [Q92851-7 ]
UniGenei Hs.5353.

3D structure databases

ProteinModelPortali Q92851.
SMRi Q92851. Positions 273-499.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107293. 88 interactions.
IntActi Q92851. 21 interactions.
MINTi MINT-201954.
STRINGi 9606.ENSP00000286186.

Chemistry

BindingDBi Q92851.
ChEMBLi CHEMBL5037.

Protein family/group databases

MEROPSi C14.011.

PTM databases

PhosphoSitei Q92851.

Polymorphism databases

DMDMi 12644463.

Proteomic databases

MaxQBi Q92851.
PaxDbi Q92851.
PRIDEi Q92851.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000272879 ; ENSP00000272879 ; ENSG00000003400 . [Q92851-1 ]
ENST00000286186 ; ENSP00000286186 ; ENSG00000003400 . [Q92851-4 ]
ENST00000313728 ; ENSP00000314599 ; ENSG00000003400 . [Q92851-6 ]
ENST00000346817 ; ENSP00000237865 ; ENSG00000003400 . [Q92851-2 ]
ENST00000360132 ; ENSP00000353250 ; ENSG00000003400 . [Q92851-3 ]
ENST00000374650 ; ENSP00000363781 ; ENSG00000003400 . [Q92851-7 ]
ENST00000448480 ; ENSP00000396835 ; ENSG00000003400 . [Q92851-5 ]
GeneIDi 843.
KEGGi hsa:843.
UCSCi uc002uxj.1. human. [Q92851-4 ]
uc002uxk.1. human. [Q92851-2 ]
uc002uxl.2. human. [Q92851-1 ]
uc002uxm.2. human. [Q92851-5 ]
uc010fta.1. human. [Q92851-6 ]
uc010ftb.2. human. [Q92851-3 ]

Organism-specific databases

CTDi 843.
GeneCardsi GC02P202047.
GeneReviewsi CASP10.
HGNCi HGNC:1500. CASP10.
HPAi CAB003780.
HPA017059.
MIMi 601762. gene.
603909. phenotype.
605027. phenotype.
613659. phenotype.
neXtProti NX_Q92851.
Orphaneti 3261. Autoimmune lymphoproliferative syndrome.
PharmGKBi PA26084.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG303276.
HOVERGENi HBG050803.
KOi K04400.
OMAi EANIEKW.
OrthoDBi EOG7CRTQM.
PhylomeDBi Q92851.
TreeFami TF102023.

Enzyme and pathway databases

BRENDAi 3.4.22.63. 2681.
Reactomei REACT_25039. NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10.
REACT_402. TRAIL signaling.
REACT_900. FasL/ CD95L signaling.

Miscellaneous databases

ChiTaRSi CASP10. human.
GeneWikii Caspase_10.
GenomeRNAii 843.
NextBioi 3530.
PMAP-CutDB Q8IUP5.
PROi Q92851.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q92851.
Bgeei Q92851.
CleanExi HS_CASP10.
Genevestigatori Q92851.

Family and domain databases

Gene3Di 1.10.533.10. 2 hits.
3.40.50.1460. 1 hit.
InterProi IPR029030. Caspase-like_dom.
IPR011029. DEATH-like_dom.
IPR001875. DED.
IPR011600. Pept_C14_caspase.
IPR001309. Pept_C14_ICE_p20.
IPR016129. Pept_C14_ICE_p20_AS.
IPR002138. Pept_C14_p10.
IPR015917. Pept_C14A_p45_core.
[Graphical view ]
Pfami PF01335. DED. 2 hits.
PF00656. Peptidase_C14. 1 hit.
[Graphical view ]
PRINTSi PR00376. IL1BCENZYME.
SMARTi SM00115. CASc. 1 hit.
SM00031. DED. 2 hits.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 2 hits.
PROSITEi PS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
PS50168. DED. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "In vitro activation of CPP32 and Mch3 by Mch4, a novel human apoptotic cysteine protease containing two FADD-like domains."
    Fernandes-Alnemri T., Armstrong R.C., Krebs J.F., Srinivasula S.M., Wang L., Bullrich F., Fritz L.C., Trapani J.A., Tomaselli K.J., Litwack G., Alnemri E.S.
    Proc. Natl. Acad. Sci. U.S.A. 93:7464-7469(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), VARIANT ILE-479 (ISOFORM B).
    Tissue: T-cell.
  2. "Fas-associated death domain protein interleukin-1beta-converting enzyme 2 (FLICE2), an ICE/Ced-3 homologue, is proximally involved in CD95- and p55-mediated death signaling."
    Vincenz C., Dixit V.M.
    J. Biol. Chem. 272:6578-6583(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
  3. "Molecular cloning and characterization of two novel pro-apoptotic isoforms of caspase-10."
    Ng P.W., Porter A.G., Janicke R.U.
    J. Biol. Chem. 274:10301-10308(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C AND D), VARIANT ILE-410, VARIANT ILE-522 (ISOFORM D).
    Tissue: Spleen and Thymus.
  4. "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2."
    Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J., Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A., Ikeda J.-E., Hayden M.R.
    Genomics 71:200-213(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS A AND B), VARIANT ILE-479 (ISOFORM B).
  5. "A novel human caspase 10 isoform participating in Fas-induced apoptosis."
    Vonarbourg C., Fischer A., Rieux-Laucat F.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), VARIANT ILE-455 (ISOFORM 6).
    Tissue: Blood.
  6. "Three novel isoforms of caspase family that are deficient of conservative CASP domain."
    Wang P.Z.
    Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
  7. NIEHS SNPs program
    Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-239; ILE-410; SER-444; CYS-446 AND ILE-522 (ISOFORM 2).
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D).
    Tissue: Brain.
  11. "Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases."
    Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G., Alnemri E.S.
    Proc. Natl. Acad. Sci. U.S.A. 93:14486-14491(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE, PROTEOLYTIC PROCESSING.
  12. "Caspase-10 is an initiator caspase in death receptor signaling."
    Wang J., Chun H.J., Wong W., Spencer D.M., Lenardo M.J.
    Proc. Natl. Acad. Sci. U.S.A. 98:13884-13888(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SELF-ASSOCIATION, INTERACTION WITH FADD, INTERACTION WITH CASP8, IDENTIFICATION IN A COMPLEX WITH FAS; FADD AND CASP8, MUTAGENESIS OF CYS-401.
  13. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  14. "Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth."
    McDonald E.R. III, El-Deiry W.S.
    Proc. Natl. Acad. Sci. U.S.A. 101:6170-6175(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RFFL, ENZYME REGULATION.
  15. "Inherited human caspase 10 mutations underlie defective lymphocyte and dendritic cell apoptosis in autoimmune lymphoproliferative syndrome type II."
    Wang J., Zheng L., Lobito A., Chan F.K., Dale J., Sneller M., Yao X., Puck J.M., Straus S.E., Lenardo M.J.
    Cell 98:47-58(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ALPS2A PHE-285, VARIANT ILE-410, ALTERNATIVE SPLICING (ISOFORMS B AND D).
  16. Cited for: VARIANT NHL VAL-414.
  17. Cited for: VARIANT GASC THR-147, CHARACTERIZATION OF VARIANT GASC THR-147.
  18. "Genetic alterations in caspase-10 may be causative or protective in autoimmune lymphoproliferative syndrome."
    Zhu S., Hsu A.P., Vacek M.M., Zheng L., Schaeffer A.A., Dale J.K., Davis J., Fischer R.E., Straus S.E., Boruchov D., Saulsbury F.T., Lenardo M.J., Puck J.M.
    Hum. Genet. 119:284-294(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ALPS2A LEU-406, VARIANTS ILE-410 AND CYS-446, CHARACTERIZATION OF VARIANTS ALPS2A LEU-406, CHARACTERIZATION OF VARIANTS ILE-410 AND CYS-446.
  19. "Genetic variants and haplotypes of the caspase-8 and caspase-10 genes contribute to susceptibility to cutaneous melanoma."
    Li C., Zhao H., Hu Z., Liu Z., Wang L.-E., Gershenwald J.E., Prieto V.G., Lee J.E., Duvic M., Grimm E.A., Wei Q.
    Hum. Mutat. 29:1443-1451(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-522 (ISOFORM D), RISK FACTOR FOR CUTANEOUS MELANOMA.
  20. "Mutational analysis of CASP10 gene in acute leukaemias and multiple myelomas."
    Kim M.S., Oh J.E., Min C.K., Lee S., Chung N.G., Yoo N.J., Lee S.H.
    Pathology 41:484-487(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-21 AND PRO-285.
  21. "Mutational analysis of CASP10 gene in colon, breast, lung and hepatocellular carcinomas."
    Oh J.E., Kim M.S., Ahn C.H., Kim S.S., Han J.Y., Lee S.H., Yoo N.J.
    Pathology 42:73-76(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT THR-14.

Entry informationi

Entry nameiCASPA_HUMAN
AccessioniPrimary (citable) accession number: Q92851
Secondary accession number(s): Q68HC0
, Q6KF62, Q6KF63, Q8IUP5, Q8WYQ8, Q99845, Q9Y2U6, Q9Y2U7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: October 1, 2014
This is version 160 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi