Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-associated protein 3

Gene

KIFAP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex (By similarity).By similarity

GO - Molecular functioni

  • kinesin binding Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-1445148. Translocation of GLUT4 to the plasma membrane.
R-HSA-2132295. MHC class II antigen presentation.
R-HSA-5620924. Intraflagellar transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.
SignaLinkiQ92845.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-associated protein 3
Short name:
KAP-3
Short name:
KAP3
Alternative name(s):
Smg GDS-associated protein
Gene namesi
Name:KIFAP3
Synonyms:KIF3AP, SMAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:17060. KIFAP3.

Subcellular locationi

GO - Cellular componenti

  • axoneme Source: Ensembl
  • centrosome Source: BHF-UCL
  • ciliary basal body Source: Ensembl
  • ciliary tip Source: Reactome
  • condensed nuclear chromosome Source: BHF-UCL
  • cytosol Source: Reactome
  • endoplasmic reticulum Source: ProtInc
  • extracellular exosome Source: UniProtKB
  • Golgi apparatus Source: Ensembl
  • intraciliary transport particle Source: Ensembl
  • kinesin II complex Source: UniProtKB
  • microtubule cytoskeleton Source: BHF-UCL
  • periciliary membrane compartment Source: Ensembl
  • photoreceptor connecting cilium Source: Ensembl
  • primary cilium Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30111.

Polymorphism and mutation databases

BioMutaiKIFAP3.
DMDMi73920216.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 792792Kinesin-associated protein 3PRO_0000084302Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei60 – 601PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC in vitro; this reduces the binding affinity of the protein for RAP1GDS1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ92845.
MaxQBiQ92845.
PaxDbiQ92845.
PRIDEiQ92845.

PTM databases

iPTMnetiQ92845.
PhosphoSiteiQ92845.

Expressioni

Gene expression databases

BgeeiQ92845.
CleanExiHS_KIFAP3.
GenevisibleiQ92845. HS.

Organism-specific databases

HPAiHPA023738.
HPA023742.

Interactioni

Subunit structurei

Heterotrimer of KIFAP3, KIF3A and KIF3B. Interacts with RAP1GDS1/SMG GDS. Interacts with SMC3 subunit of the cohesin complex.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KIF3AQ9Y4965EBI-954040,EBI-1104844
KIF3BO150664EBI-954040,EBI-3931791
NAA10P412273EBI-954040,EBI-747693
NCF2P198784EBI-954040,EBI-489611

GO - Molecular functioni

  • kinesin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi116582. 66 interactions.
IntActiQ92845. 48 interactions.
MINTiMINT-6942059.
STRINGi9606.ENSP00000354560.

Structurei

3D structure databases

ProteinModelPortaliQ92845.
SMRiQ92845. Positions 127-193, 304-375.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati333 – 37341ARM 1Add
BLAST
Repeati374 – 41239ARM 2Add
BLAST
Repeati494 – 53340ARM 3Add
BLAST
Repeati578 – 62043ARM 4Add
BLAST
Repeati621 – 66242ARM 5Add
BLAST

Sequence similaritiesi

Contains 5 ARM repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1222. Eukaryota.
ENOG410XT8I. LUCA.
GeneTreeiENSGT00390000003574.
HOGENOMiHOG000012952.
HOVERGENiHBG052257.
InParanoidiQ92845.
OMAiFYSADGI.
OrthoDBiEOG7B5WVK.
PhylomeDBiQ92845.
TreeFamiTF314964.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR008658. KAP3.
[Graphical view]
PANTHERiPTHR15605. PTHR15605. 1 hit.
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92845-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGEDARYLK RKVKGGNIDV HPSEKALIVH YEVEATILGE MGDPMLGERK
60 70 80 90 100
ECQKIIRLKS LNANTDITSL ARKVVEECKL IHPSKLNEVE QLLYYLQNRR
110 120 130 140 150
DSLSGKEKKE KSSKPKDPPP FEGMEIDEVA NINDMDEYIE LLYEDIPDKV
160 170 180 190 200
RGSALILQLA RNPDNLEELL LNETALGALA RVLREDWKQS VELATNIIYI
210 220 230 240 250
FFCFSSFSQF HGLITHYKIG ALCMNIIDHE LKRHELWQEE LSKKKKAVDE
260 270 280 290 300
DPENQTLRKD YEKTFKKYQG LVVKQEQLLR VALYLLLNLA EDTRTELKMR
310 320 330 340 350
NKNIVHMLVK ALDRDNFELL ILVVSFLKKL SIFMENKNDM VEMDIVEKLV
360 370 380 390 400
KMIPCEHEDL LNITLRLLLN LSFDTGLRNK MVQVGLLPKL TALLGNDNYK
410 420 430 440 450
QIAMCVLYHI SMDDRFKSMF AYTDCIPQLM KMLFECSDER IDLELISFCI
460 470 480 490 500
NLAANKRNVQ LICEGNGLKM LMKRALKFKD PLLMKMIRNI SQHDGPTKNL
510 520 530 540 550
FIDYVGDLAA QISNDEEEEF VIECLGTLAN LTIPDLDWEL VLKEYKLVPY
560 570 580 590 600
LKDKLKPGAA EDDLVLEVVI MIGTVSMDDS CAALLAKSGI IPALIELLNA
610 620 630 640 650
QQEDDEFVCQ IIYVFYQMVF HQATRDVIIK ETQAPAYLID LMHDKNNEIR
660 670 680 690 700
KVCDNTLDII AEYDEEWAKK IQSEKFRWHN SQWLEMVESR QMDESEQYLY
710 720 730 740 750
GDDRIEPYIH EGDILERPDL FYNSDGLIAS EGAISPDFFN DYHLQNGDVV
760 770 780 790
GQHSFPGSLG MDGFGQPVGI LGRPATAYGF RPDEPYYYGY GS
Length:792
Mass (Da):91,205
Last modified:August 30, 2005 - v2
Checksum:i1887A75D811DF56A
GO
Isoform 2 (identifier: Q92845-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-55: RKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKI → S

Note: No experimental confirmation available.
Show »
Length:748
Mass (Da):86,290
Checksum:i7183BDA516248AC4
GO
Isoform 3 (identifier: Q92845-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Note: No experimental confirmation available.
Show »
Length:752
Mass (Da):86,728
Checksum:i65A2E06360616022
GO
Isoform 4 (identifier: Q92845-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: MQGEDARYLK...QNRRDSLSGK → MSIALGNTYRRSLSDSETVSVLQASLCE

Show »
Length:714
Mass (Da):82,144
Checksum:iCF12D8DEF30AF92B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti91 – 911Q → L in AAC50788 (PubMed:8900189).Curated
Sequence conflicti734 – 7341I → V in BAH13889 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti513 – 5131S → A.
Corresponds to variant rs12075833 [ dbSNP | Ensembl ].
VAR_051081

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 106106MQGED…SLSGK → MSIALGNTYRRSLSDSETVS VLQASLCE in isoform 4. 1 PublicationVSP_047132Add
BLAST
Alternative sequencei1 – 4040Missing in isoform 3. CuratedVSP_047133Add
BLAST
Alternative sequencei11 – 5545RKVKG…ECQKI → S in isoform 2. 1 PublicationVSP_044505Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59919 mRNA. Translation: AAC50788.1.
AK297368 mRNA. Translation: BAH12562.1.
AK303052 mRNA. Translation: BAH13889.1.
AK315586 mRNA. Translation: BAG37958.1.
AL356475, AL121714 Genomic DNA. Translation: CAH72581.1.
AL356475, AL121714 Genomic DNA. Translation: CAH72582.1.
AL121714, AL356475 Genomic DNA. Translation: CAI19740.1.
AL121714, AL356475 Genomic DNA. Translation: CAI19741.1.
CH471067 Genomic DNA. Translation: EAW90872.1.
CH471067 Genomic DNA. Translation: EAW90873.1.
CH471067 Genomic DNA. Translation: EAW90871.1.
BC028679 mRNA. Translation: AAH28679.1.
CCDSiCCDS1288.1. [Q92845-1]
CCDS55659.1. [Q92845-4]
CCDS55660.1. [Q92845-3]
CCDS55661.1. [Q92845-2]
RefSeqiNP_001191443.1. NM_001204514.1. [Q92845-4]
NP_001191445.1. NM_001204516.1. [Q92845-2]
NP_001191446.1. NM_001204517.1. [Q92845-3]
NP_055785.2. NM_014970.3. [Q92845-1]
UniGeneiHs.433442.

Genome annotation databases

EnsembliENST00000361580; ENSP00000354560; ENSG00000075945. [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945. [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945. [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945. [Q92845-4]
GeneIDi22920.
KEGGihsa:22920.
UCSCiuc001ggv.4. human. [Q92845-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59919 mRNA. Translation: AAC50788.1.
AK297368 mRNA. Translation: BAH12562.1.
AK303052 mRNA. Translation: BAH13889.1.
AK315586 mRNA. Translation: BAG37958.1.
AL356475, AL121714 Genomic DNA. Translation: CAH72581.1.
AL356475, AL121714 Genomic DNA. Translation: CAH72582.1.
AL121714, AL356475 Genomic DNA. Translation: CAI19740.1.
AL121714, AL356475 Genomic DNA. Translation: CAI19741.1.
CH471067 Genomic DNA. Translation: EAW90872.1.
CH471067 Genomic DNA. Translation: EAW90873.1.
CH471067 Genomic DNA. Translation: EAW90871.1.
BC028679 mRNA. Translation: AAH28679.1.
CCDSiCCDS1288.1. [Q92845-1]
CCDS55659.1. [Q92845-4]
CCDS55660.1. [Q92845-3]
CCDS55661.1. [Q92845-2]
RefSeqiNP_001191443.1. NM_001204514.1. [Q92845-4]
NP_001191445.1. NM_001204516.1. [Q92845-2]
NP_001191446.1. NM_001204517.1. [Q92845-3]
NP_055785.2. NM_014970.3. [Q92845-1]
UniGeneiHs.433442.

3D structure databases

ProteinModelPortaliQ92845.
SMRiQ92845. Positions 127-193, 304-375.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116582. 66 interactions.
IntActiQ92845. 48 interactions.
MINTiMINT-6942059.
STRINGi9606.ENSP00000354560.

PTM databases

iPTMnetiQ92845.
PhosphoSiteiQ92845.

Polymorphism and mutation databases

BioMutaiKIFAP3.
DMDMi73920216.

Proteomic databases

EPDiQ92845.
MaxQBiQ92845.
PaxDbiQ92845.
PRIDEiQ92845.

Protocols and materials databases

DNASUi22920.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361580; ENSP00000354560; ENSG00000075945. [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945. [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945. [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945. [Q92845-4]
GeneIDi22920.
KEGGihsa:22920.
UCSCiuc001ggv.4. human. [Q92845-1]

Organism-specific databases

CTDi22920.
GeneCardsiKIFAP3.
HGNCiHGNC:17060. KIFAP3.
HPAiHPA023738.
HPA023742.
MIMi601836. gene.
neXtProtiNX_Q92845.
PharmGKBiPA30111.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1222. Eukaryota.
ENOG410XT8I. LUCA.
GeneTreeiENSGT00390000003574.
HOGENOMiHOG000012952.
HOVERGENiHBG052257.
InParanoidiQ92845.
OMAiFYSADGI.
OrthoDBiEOG7B5WVK.
PhylomeDBiQ92845.
TreeFamiTF314964.

Enzyme and pathway databases

ReactomeiR-HSA-1445148. Translocation of GLUT4 to the plasma membrane.
R-HSA-2132295. MHC class II antigen presentation.
R-HSA-5620924. Intraflagellar transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.
SignaLinkiQ92845.

Miscellaneous databases

ChiTaRSiKIFAP3. human.
GeneWikiiKIFAP3.
GenomeRNAii22920.
PROiQ92845.
SOURCEiSearch...

Gene expression databases

BgeeiQ92845.
CleanExiHS_KIFAP3.
GenevisibleiQ92845. HS.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR008658. KAP3.
[Graphical view]
PANTHERiPTHR15605. PTHR15605. 1 hit.
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "SMAP, an Smg GDS-associating protein having arm repeats and phosphorylated by src tyrosine kinase."
    Shimizu K., Kawabe H., Minami S., Honda T., Takaishi K., Shirataki H., Takai Y.
    J. Biol. Chem. 271:27013-27017(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH RAP1GDS1, PHOSPHORYLATION.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Brain, Placenta and Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "Complex formation of SMAP/KAP3, a KIF3A/B ATPase motor-associated protein, with a human chromosome-associated polypeptide."
    Shimizu K., Shirataki H., Honda T., Minami S., Takai Y.
    J. Biol. Chem. 273:6591-6594(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH SMC3 AND KIF3B.
  7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiKIFA3_HUMAN
AccessioniPrimary (citable) accession number: Q92845
Secondary accession number(s): B1AKU4
, B1AKU5, B2RDL1, B7Z8A3, F5H591, Q8NHU7, Q9H416
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: August 30, 2005
Last modified: June 8, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.