Q92813 (IOD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Type II iodothyronine deiodinase EC=1.97.1.10 Alternative name(s): 5DII DIOII Type 2 DI Type-II 5'-deiodinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 273 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development. |
| Catalytic activity | 3,5,3'-triiodo-L-thyronine + iodide + A + H+ = L-thyroxine + AH2. |
| Subunit structure | Interacts with USP20 and USP33. Interacts with MARCH6. Ref.7 Ref.8 |
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
| Tissue specificity | Heart, skeletal muscle, placenta, fetal brain and several regions of the adult brain. |
| Post-translational modification | Ubiquitinated by MARCH6, leading to its degradation by the proteasome. Deubiquitinated by USP20 and USP33. Ref.7 Ref.8 |
| Sequence similarities | Belongs to the iodothyronine deiodinase family. |
| Sequence caution | The sequence AAC95470.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92813-1) Also known as: hDII-a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92813-2) Also known as: hDII-b; The sequence of this isoform differs from the canonical sequence as follows: 74-74: Q → QLNCPPSGFSKDGHILCLVYEAYKSRLLVYSHLDLWM | ||||||
| Note: Has a Sec in positions 169 and 302. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 273 | 273 | Type II iodothyronine deiodinase | PRO_0000154317 | |||||
Regions | |||||||||
| Transmembrane | 10 – 34 | 25 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 133 | 1 | |||||||
Amino acid modifications | |||||||||
| Non-standard residue | 133 | 1 | Selenocysteine | ||||||
| Non-standard residue | 266 | 1 | Selenocysteine | ||||||
Natural variations | |||||||||
| Alternative sequence | 74 | 1 | Q → QLNCPPSGFSKDGHILCLVY EAYKSRLLVYSHLDLWM in isoform 2. | VSP_026154 | |||||
| Natural variant | 81 | 1 | A → D. Corresponds to variant rs2839859 [ dbSNP | Ensembl ]. | VAR_049640 | |||||
| Natural variant | 92 | 1 | T → A. Corresponds to variant rs225014 [ dbSNP | Ensembl ]. | VAR_047549 | |||||
Experimental info | |||||||||
| Sequence conflict | 198 | 1 | L → P in BAB16838. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the mammalian type II iodothyronine deiodinase. A selenoprotein differentially expressed and regulated in human and rat brain and other tissues." Croteau W., Davey J.C., Galton V.A., St Germain D.L. J. Clin. Invest. 98:405-417(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The 3'-untranslated region of human type 2 iodothyronine deiodinase mRNA contains a functional selenocysteine insertion sequence element." Buettner C., Harney J.W., Larsen P.R. J. Biol. Chem. 273:33374-33378(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Identification of two novel splicing variants of human type II iodothyronine deiodinase mRNA." Ohba K., Yoshioka T., Muraki T. Mol. Cell. Endocrinol. 172:169-175(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Umbilical vein. |
| [4] | "Sequencing of human chromosome 14q31 region." Dickhoff R., Madan A., Qin S., Abbasi N., Dors M., Rowen L., Harrison G., James R., Loretz C., Lasky S., Madan A., Prescott S., Ratcliffe A., Shaffer T., Hood L. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Testis. |
| [7] | "Deubiquitination of type 2 iodothyronine deiodinase by von Hippel-Lindau protein-interacting deubiquitinating enzymes regulates thyroid hormone activation." Curcio-Morelli C., Zavacki A.M., Christofollete M., Gereben B., de Freitas B.C., Harney J.W., Li Z., Wu G., Bianco A.C. J. Clin. Invest. 112:189-196(2003) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, DEUBIQUITINATION BY USP20 AND USP33, INTERACTION WITH USP20 AND USP33. |
| [8] | "The E3 ubiquitin ligase TEB4 mediates degradation of type 2 iodothyronine deiodinase." Zavacki A.M., Arrojo E Drigo R., Freitas B.C., Chung M., Harney J.W., Egri P., Wittmann G., Fekete C., Gereben B., Bianco A.C. Mol. Cell. Biol. 29:5339-5347(2009) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY MARCH6, INTERACTION WITH MARCH6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U53506 mRNA. Translation: AAC50663.1. AF093774 mRNA. Translation: AAC95470.1. Different initiation. AB041843 mRNA. Translation: BAB16838.1. AC007372 Genomic DNA. Translation: AAD45494.1. AC010849 Genomic DNA. No translation available. AL049837 Genomic DNA. No translation available. BC074882 mRNA. Translation: AAH74882.1. BC136514 mRNA. Translation: AAI36515.1. |
| IPI | IPI00030716. IPI00465076. |
| RefSeq | NP_000784.2. NM_000793.5. NP_001007024.1. NM_001007023.3. NP_001229431.1. NM_001242502.1. NP_001229432.1. NM_001242503.1. NP_054644.1. NM_013989.4. |
| UniGene | Hs.202354. Hs.708526. Hs.732170. |
3D structure databases | |
| ProteinModelPortal | Q92813. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000373490. |
Polymorphism databases | |
| DMDM | 172045839. |
Proteomic databases | |
| PaxDb | Q92813. |
| PRIDE | Q92813. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000438257; ENSP00000405854; ENSG00000211448. ENST00000557010; ENSP00000451419; ENSG00000211448. |
| GeneID | 1734. |
| KEGG | hsa:1734. |
| UCSC | uc010asy.3. human. uc021rxa.1. human. |
Organism-specific databases | |
| CTD | 1734. |
| GeneCards | GC14M080663. |
| HGNC | HGNC:2884. DIO2. |
| HPA | HPA029544. |
| MIM | 601413. gene. |
| neXtProt | NX_Q92813. |
| PharmGKB | PA27338. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG146259. |
| HOGENOM | HOG000007088. |
| HOVERGEN | HBG000099. |
| InParanoid | Q92813. |
| KO | K01562. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS00008-MONOMER. |
| BRENDA | 1.97.1.10. 2681. |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | Q92813. |
Gene expression databases | |
| ArrayExpress | Q92813. |
| Bgee | Q92813. |
| CleanEx | HS_DIO2. |
| Genevestigator | Q92813. |
| GermOnline | ENSG00000211448. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.30.10. 1 hit. |
| InterPro | IPR000643. Iodothyronine_deiodinase. IPR008261. Iodothyronine_deiodinase_AS. IPR012336. Thioredoxin-like_fold. [Graphical view] |
| PANTHER | PTHR11781. PTHR11781. 1 hit. |
| Pfam | PF00837. T4_deiodinase. 1 hit. [Graphical view] |
| PIRSF | PIRSF001330. IOD. 1 hit. |
| PROSITE | PS01205. T4_DEIODINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL2054. |
| GenomeRNAi | 1734. |
| NextBio | 35516965. |
| SOURCE | Search... |
Entry information
| Entry name | IOD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92813 Secondary accession number(s): B9EGK0 Q9UDZ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
