Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Symplekin

Gene

SYMPK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Scaffold protein that functions as a component of a multimolecular complex involved in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. Is involved in pre-mRNA polyadenylation. Enhances SSU72 phosphatase activity.2 Publications

GO - Biological processi

  • cell adhesion Source: UniProtKB-KW
  • mRNA polyadenylation Source: UniProtKB
  • positive regulation of protein dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, mRNA processing

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125755-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Symplekin
Gene namesi
Name:SYMPK
Synonyms:SPK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:22935. SYMPK.

Subcellular locationi

GO - Cellular componenti

  • bicellular tight junction Source: UniProtKB-SubCell
  • cytoplasm Source: UniProtKB
  • cytoskeleton Source: UniProtKB-SubCell
  • nucleoplasm Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi185K → A: Abolishes stimulation of SSU72 phosphatase activity. 1 Publication1

Organism-specific databases

DisGeNETi8189.
OpenTargetsiENSG00000125755.
PharmGKBiPA134896920.

Polymorphism and mutation databases

BioMutaiSYMPK.
DMDMi71153180.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000723851 – 1274SymplekinAdd BLAST1274

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Cross-linki361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki483Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei494PhosphoserineCombined sources1
Modified residuei1221PhosphoserineCombined sources1
Modified residuei1222PhosphoserineCombined sources1
Cross-linki1239Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1257PhosphothreonineCombined sources1
Modified residuei1259PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ92797.
MaxQBiQ92797.
PaxDbiQ92797.
PeptideAtlasiQ92797.
PRIDEiQ92797.

PTM databases

iPTMnetiQ92797.
PhosphoSitePlusiQ92797.

Expressioni

Tissue specificityi

In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node.1 Publication

Gene expression databases

BgeeiENSG00000125755.
CleanExiHS_SYMPK.
ExpressionAtlasiQ92797. baseline and differential.
GenevisibleiQ92797. HS.

Organism-specific databases

HPAiHPA041756.
HPA042449.

Interactioni

Subunit structurei

Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors. Interacts with CPSF2, CPSF3 and CSTF2. Interacts with HSF1 in heat-stressed cells. Interacts with SSU72.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CPSF2Q9P2I03EBI-1051992,EBI-1043224

Protein-protein interaction databases

BioGridi113833. 53 interactors.
DIPiDIP-42506N.
IntActiQ92797. 30 interactors.
MINTiMINT-1537611.
STRINGi9606.ENSP00000245934.

Structurei

Secondary structure

11274
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi32 – 45Combined sources14
Helixi50 – 63Combined sources14
Helixi67 – 73Combined sources7
Helixi74 – 78Combined sources5
Helixi79 – 82Combined sources4
Helixi86 – 102Combined sources17
Helixi104 – 106Combined sources3
Helixi107 – 118Combined sources12
Helixi123 – 146Combined sources24
Helixi152 – 170Combined sources19
Helixi171 – 173Combined sources3
Helixi177 – 193Combined sources17
Helixi205 – 207Combined sources3
Helixi213 – 215Combined sources3
Beta strandi221 – 223Combined sources3
Helixi225 – 242Combined sources18
Helixi250 – 266Combined sources17
Helixi268 – 270Combined sources3
Helixi271 – 283Combined sources13
Helixi287 – 289Combined sources3
Helixi291 – 293Combined sources3
Helixi294 – 309Combined sources16
Helixi312 – 317Combined sources6
Helixi318 – 327Combined sources10
Helixi332 – 337Combined sources6
Helixi342 – 345Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3O2QX-ray2.40A/D30-360[»]
3O2SX-ray2.50A30-360[»]
3O2TX-ray1.40A30-395[»]
3ODRX-ray2.20A1-395[»]
3ODSX-ray1.90A1-395[»]
4H3HX-ray2.20A/D30-360[»]
4H3KX-ray2.00A/D30-360[»]
ProteinModelPortaliQ92797.
SMRiQ92797.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92797.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati31 – 64HEAT 1Add BLAST34
Repeati67 – 101HEAT 2Add BLAST35
Repeati104 – 146HEAT 3Add BLAST43
Repeati153 – 192HEAT 4Add BLAST40
Repeati227 – 266HEAT 5Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 124Interaction with HSF11 PublicationAdd BLAST124

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi345 – 360Nuclear localization signalSequence analysisAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1168 – 1175Poly-Ser8

Domaini

The HEAT repeats have been determined based on 3D-structure analysis of the D.melanogaster ortholog and are not detected by sequence-based prediction programs.

Sequence similaritiesi

Belongs to the Symplekin family.Curated
Contains 5 HEAT repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1895. Eukaryota.
ENOG410XQAS. LUCA.
GeneTreeiENSGT00390000017045.
HOGENOMiHOG000046745.
HOVERGENiHBG062441.
InParanoidiQ92797.
KOiK06100.
OMAiNDGIRTN.
OrthoDBiEOG091G02S0.
PhylomeDBiQ92797.
TreeFamiTF312860.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR021850. Symplekin/Pta1.
IPR032460. Symplekin/Pta1_N.
IPR022075. Symplekin_C.
[Graphical view]
PANTHERiPTHR15245:SF20. PTHR15245:SF20. 1 hit.
PfamiPF11935. DUF3453. 1 hit.
PF12295. Symplekin_C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q92797-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASGSGDSVT RRSVASQFFT QEEGPGIDGM TTSERVVDLL NQAALITNDS
60 70 80 90 100
KITVLKQVQE LIINKDPTLL DNFLDEIIAF QADKSIEVRK FVIGFIEEAC
110 120 130 140 150
KRDIELLLKL IANLNMLLRD ENVNVVKKAI LTMTQLYKVA LQWMVKSRVI
160 170 180 190 200
SELQEACWDM VSAMAGDIIL LLDSDNDGIR THAIKFVEGL IVTLSPRMAD
210 220 230 240 250
SEIPRRQEHD ISLDRIPRDH PYIQYNVLWE EGKAALEQLL KFMVHPAISS
260 270 280 290 300
INLTTALGSL ANIARQRPMF MSEVIQAYET LHANLPPTLA KSQVSSVRKN
310 320 330 340 350
LKLHLLSVLK HPASLEFQAQ ITTLLVDLGT PQAEIARNMP SSKDTRKRPR
360 370 380 390 400
DDSDSTLKKM KLEPNLGEDD EDKDLEPGPS GTSKASAQIS GQSDTDITAE
410 420 430 440 450
FLQPLLTPDN VANLVLISMV YLPEAMPASF QAIYTPVESA GTEAQIKHLA
460 470 480 490 500
RLMATQMTAA GLGPGVEQTK QCKEEPKEEK VVKTESVLIK RRLSAQGQAI
510 520 530 540 550
SVVGSLSSMS PLEEEAPQAK RRPEPIIPVT QPRLAGAGGR KKIFRLSDVL
560 570 580 590 600
KPLTDAQVEA MKLGAVKRIL RAEKAVACSG AAQVRIKILA SLVTQFNSGL
610 620 630 640 650
KAEVLSFILE DVRARLDLAF AWLYQEYNAY LAAGASGSLD KYEDCLIRLL
660 670 680 690 700
SGLQEKPDQK DGIFTKVVLE APLITESALE VVRKYCEDES RTYLGMSTLR
710 720 730 740 750
DLIFKRPSRQ FQYLHVLLDL SSHEKDKVRS QALLFIKRMY EKEQLREYVE
760 770 780 790 800
KFALNYLQLL VHPNPPSVLF GADKDTEVAA PWTEETVKQC LYLYLALLPQ
810 820 830 840 850
NHKLIHELAA VYTEAIADIK RTVLRVIEQP IRGMGMNSPE LLLLVENCPK
860 870 880 890 900
GAETLVTRCL HSLTDKVPPS PELVKRVRDL YHKRLPDVRF LIPVLNGLEK
910 920 930 940 950
KEVIQALPKL IKLNPIVVKE VFNRLLGTQH GEGNSALSPL NPGELLIALH
960 970 980 990 1000
NIDSVKCDMK SIIKATNLCF AERNVYTSEV LAVVMQQLME QSPLPMLLMR
1010 1020 1030 1040 1050
TVIQSLTMYP RLGGFVMNIL SRLIMKQVWK YPKVWEGFIK CCQRTKPQSF
1060 1070 1080 1090 1100
QVILQLPPQQ LGAVFDKCPE LREPLLAHVR SFTPHQQAHI PNSIMTILEA
1110 1120 1130 1140 1150
SGKQEPEAKE APAGPLEEDD LEPLTLAPAP APRPPQDLIG LRLAQEKALK
1160 1170 1180 1190 1200
RQLEEEQKLK PGGVGAPSSS SPSPSPSARP GPPPSEEAMD FREEGPECET
1210 1220 1230 1240 1250
PGIFISMDDD SGLTEAALLD SSLEGPLPKE TAAGGLTLKE ERSPQTLAPV
1260 1270
GEDAMKTPSP AAEDAREPEA KGNS
Length:1,274
Mass (Da):141,148
Last modified:July 19, 2005 - v2
Checksum:iD8AD9ABB0B25A688
GO
Isoform 2 (identifier: Q92797-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     637-672: GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAP → PRLCWRRHSSQRVPWRWSASTARMRVAPIWACPHFET
     673-1274: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:673
Mass (Da):74,523
Checksum:iE5939FC7FFDAA3AA
GO

Sequence cautioni

The sequence AAC50667 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH30214 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAD92261 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA71861 differs from that shown. Reason: Frameshift at position 67.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014842637 – 672GSLDK…VLEAP → PRLCWRRHSSQRVPWRWSAS TARMRVAPIWACPHFET in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_014843673 – 1274Missing in isoform 2. 1 PublicationAdd BLAST602

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10931 mRNA. Translation: CAA71861.1. Frameshift.
AB209024 mRNA. Translation: BAD92261.1. Different initiation.
U88726 mRNA. Translation: AAB58578.1.
BC006536 mRNA. Translation: AAH06536.2.
BC006567 mRNA. Translation: AAH06567.2.
BC030214 mRNA. Translation: AAH30214.1. Sequence problems.
U49240 mRNA. Translation: AAC50667.1. Different initiation.
DB328640 mRNA. No translation available.
CCDSiCCDS12676.2. [Q92797-1]
RefSeqiNP_004810.2. NM_004819.2. [Q92797-1]
XP_005259343.1. XM_005259286.1. [Q92797-1]
XP_011525656.1. XM_011527354.1. [Q92797-1]
UniGeneiHs.515475.

Genome annotation databases

EnsembliENST00000245934; ENSP00000245934; ENSG00000125755. [Q92797-1]
GeneIDi8189.
KEGGihsa:8189.
UCSCiuc002pdn.4. human. [Q92797-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10931 mRNA. Translation: CAA71861.1. Frameshift.
AB209024 mRNA. Translation: BAD92261.1. Different initiation.
U88726 mRNA. Translation: AAB58578.1.
BC006536 mRNA. Translation: AAH06536.2.
BC006567 mRNA. Translation: AAH06567.2.
BC030214 mRNA. Translation: AAH30214.1. Sequence problems.
U49240 mRNA. Translation: AAC50667.1. Different initiation.
DB328640 mRNA. No translation available.
CCDSiCCDS12676.2. [Q92797-1]
RefSeqiNP_004810.2. NM_004819.2. [Q92797-1]
XP_005259343.1. XM_005259286.1. [Q92797-1]
XP_011525656.1. XM_011527354.1. [Q92797-1]
UniGeneiHs.515475.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3O2QX-ray2.40A/D30-360[»]
3O2SX-ray2.50A30-360[»]
3O2TX-ray1.40A30-395[»]
3ODRX-ray2.20A1-395[»]
3ODSX-ray1.90A1-395[»]
4H3HX-ray2.20A/D30-360[»]
4H3KX-ray2.00A/D30-360[»]
ProteinModelPortaliQ92797.
SMRiQ92797.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113833. 53 interactors.
DIPiDIP-42506N.
IntActiQ92797. 30 interactors.
MINTiMINT-1537611.
STRINGi9606.ENSP00000245934.

PTM databases

iPTMnetiQ92797.
PhosphoSitePlusiQ92797.

Polymorphism and mutation databases

BioMutaiSYMPK.
DMDMi71153180.

Proteomic databases

EPDiQ92797.
MaxQBiQ92797.
PaxDbiQ92797.
PeptideAtlasiQ92797.
PRIDEiQ92797.

Protocols and materials databases

DNASUi8189.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245934; ENSP00000245934; ENSG00000125755. [Q92797-1]
GeneIDi8189.
KEGGihsa:8189.
UCSCiuc002pdn.4. human. [Q92797-1]

Organism-specific databases

CTDi8189.
DisGeNETi8189.
GeneCardsiSYMPK.
H-InvDBHIX0015243.
HGNCiHGNC:22935. SYMPK.
HPAiHPA041756.
HPA042449.
MIMi602388. gene.
neXtProtiNX_Q92797.
OpenTargetsiENSG00000125755.
PharmGKBiPA134896920.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1895. Eukaryota.
ENOG410XQAS. LUCA.
GeneTreeiENSGT00390000017045.
HOGENOMiHOG000046745.
HOVERGENiHBG062441.
InParanoidiQ92797.
KOiK06100.
OMAiNDGIRTN.
OrthoDBiEOG091G02S0.
PhylomeDBiQ92797.
TreeFamiTF312860.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125755-MONOMER.

Miscellaneous databases

ChiTaRSiSYMPK. human.
EvolutionaryTraceiQ92797.
GeneWikiiSYMPK.
GenomeRNAii8189.
PROiQ92797.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125755.
CleanExiHS_SYMPK.
ExpressionAtlasiQ92797. baseline and differential.
GenevisibleiQ92797. HS.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR021850. Symplekin/Pta1.
IPR032460. Symplekin/Pta1_N.
IPR022075. Symplekin_C.
[Graphical view]
PANTHERiPTHR15245:SF20. PTHR15245:SF20. 1 hit.
PfamiPF11935. DUF3453. 1 hit.
PF12295. Symplekin_C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiSYMPK_HUMAN
AccessioniPrimary (citable) accession number: Q92797
Secondary accession number(s): O00521
, O00689, O00733, Q59GT5, Q8N2U5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 19, 2005
Last modified: November 30, 2016
This is version 154 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Could be used as a differentiation marker in the differential diagnosis of tumors.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.