Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92797

- SYMPK_HUMAN

UniProt

Q92797 - SYMPK_HUMAN

Protein

Symplekin

Gene

SYMPK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 2 (19 Jul 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Scaffold protein that functions as a component of a multimolecular complex involved in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. Is involved in pre-mRNA polyadenylation. Enhances SSU72 phosphatase activity.2 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. mRNA polyadenylation Source: UniProtKB
    3. positive regulation of protein dephosphorylation Source: UniProtKB

    Keywords - Biological processi

    Cell adhesion, mRNA processing

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Symplekin
    Gene namesi
    Name:SYMPK
    Synonyms:SPK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:22935. SYMPK.

    Subcellular locationi

    Cytoplasmcytoskeleton. Cell junctiontight junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction. Nucleusnucleoplasm
    Note: Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without TJ). Nuclear bodies of heat-stressed cells.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytoskeleton Source: UniProtKB-SubCell
    3. nucleoplasm Source: UniProtKB
    4. nucleus Source: HPA
    5. plasma membrane Source: HPA
    6. tight junction Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus, Tight junction

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi185 – 1851K → A: Abolishes stimulation of SSU72 phosphatase activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA134896920.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12741274SymplekinPRO_0000072385Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei494 – 4941Phosphoserine1 Publication
    Modified residuei1243 – 12431Phosphoserine2 Publications
    Modified residuei1257 – 12571Phosphothreonine1 Publication
    Modified residuei1259 – 12591Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ92797.
    PaxDbiQ92797.
    PRIDEiQ92797.

    PTM databases

    PhosphoSiteiQ92797.

    Expressioni

    Tissue specificityi

    In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node.1 Publication

    Gene expression databases

    ArrayExpressiQ92797.
    BgeeiQ92797.
    CleanExiHS_SYMPK.
    GenevestigatoriQ92797.

    Organism-specific databases

    HPAiHPA041756.
    HPA055661.

    Interactioni

    Subunit structurei

    Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors. Interacts with CPSF2, CPSF3 and CSTF2. Interacts with HSF1 in heat-stressed cells. Interacts with SSU72.6 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CPSF2Q9P2I02EBI-1051992,EBI-1043224

    Protein-protein interaction databases

    BioGridi113833. 16 interactions.
    DIPiDIP-42506N.
    IntActiQ92797. 5 interactions.
    MINTiMINT-1537611.
    STRINGi9606.ENSP00000245934.

    Structurei

    Secondary structure

    1
    1274
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi32 – 4514
    Helixi50 – 6314
    Helixi67 – 737
    Helixi74 – 785
    Helixi79 – 824
    Helixi86 – 10217
    Helixi104 – 1063
    Helixi107 – 11812
    Helixi123 – 14624
    Helixi152 – 17019
    Helixi171 – 1733
    Helixi177 – 19317
    Helixi205 – 2073
    Helixi213 – 2153
    Beta strandi221 – 2233
    Helixi225 – 24218
    Helixi250 – 26617
    Helixi268 – 2703
    Helixi271 – 28313
    Helixi287 – 2893
    Helixi291 – 2933
    Helixi294 – 30916
    Helixi312 – 3176
    Helixi318 – 32710
    Helixi332 – 3376
    Helixi342 – 3454

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3O2QX-ray2.40A/D30-360[»]
    3O2SX-ray2.50A30-360[»]
    3O2TX-ray1.40A30-395[»]
    3ODRX-ray2.20A1-395[»]
    3ODSX-ray1.90A1-395[»]
    4H3HX-ray2.20A/D30-360[»]
    4H3KX-ray2.00A/D30-360[»]
    ProteinModelPortaliQ92797.
    SMRiQ92797. Positions 30-349.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ92797.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati31 – 6434HEAT 1Add
    BLAST
    Repeati67 – 10135HEAT 2Add
    BLAST
    Repeati104 – 14643HEAT 3Add
    BLAST
    Repeati153 – 19240HEAT 4Add
    BLAST
    Repeati227 – 26640HEAT 5Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 124124Interaction with HSF1Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi345 – 36016Nuclear localization signalSequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1168 – 11758Poly-Ser

    Domaini

    The HEAT repeats have been determined based on 3D-structure analysis of the D.melanogaster ortholog and are not detected by sequence-based prediction programs.

    Sequence similaritiesi

    Belongs to the Symplekin family.Curated
    Contains 5 HEAT repeats.Curated

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG273943.
    HOGENOMiHOG000046745.
    HOVERGENiHBG062441.
    InParanoidiQ92797.
    KOiK06100.
    OMAiEACKRDN.
    OrthoDBiEOG7RZ5PC.
    PhylomeDBiQ92797.
    TreeFamiTF312860.

    Family and domain databases

    Gene3Di1.25.10.10. 3 hits.
    InterProiIPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR021850. Symplekin/Pta1.
    IPR022075. Symplekin_C.
    [Graphical view]
    PANTHERiPTHR15245:SF20. PTHR15245:SF20. 1 hit.
    PfamiPF12295. Symplekin_C. 1 hit.
    [Graphical view]
    SUPFAMiSSF48371. SSF48371. 3 hits.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q92797-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASGSGDSVT RRSVASQFFT QEEGPGIDGM TTSERVVDLL NQAALITNDS     50
    KITVLKQVQE LIINKDPTLL DNFLDEIIAF QADKSIEVRK FVIGFIEEAC 100
    KRDIELLLKL IANLNMLLRD ENVNVVKKAI LTMTQLYKVA LQWMVKSRVI 150
    SELQEACWDM VSAMAGDIIL LLDSDNDGIR THAIKFVEGL IVTLSPRMAD 200
    SEIPRRQEHD ISLDRIPRDH PYIQYNVLWE EGKAALEQLL KFMVHPAISS 250
    INLTTALGSL ANIARQRPMF MSEVIQAYET LHANLPPTLA KSQVSSVRKN 300
    LKLHLLSVLK HPASLEFQAQ ITTLLVDLGT PQAEIARNMP SSKDTRKRPR 350
    DDSDSTLKKM KLEPNLGEDD EDKDLEPGPS GTSKASAQIS GQSDTDITAE 400
    FLQPLLTPDN VANLVLISMV YLPEAMPASF QAIYTPVESA GTEAQIKHLA 450
    RLMATQMTAA GLGPGVEQTK QCKEEPKEEK VVKTESVLIK RRLSAQGQAI 500
    SVVGSLSSMS PLEEEAPQAK RRPEPIIPVT QPRLAGAGGR KKIFRLSDVL 550
    KPLTDAQVEA MKLGAVKRIL RAEKAVACSG AAQVRIKILA SLVTQFNSGL 600
    KAEVLSFILE DVRARLDLAF AWLYQEYNAY LAAGASGSLD KYEDCLIRLL 650
    SGLQEKPDQK DGIFTKVVLE APLITESALE VVRKYCEDES RTYLGMSTLR 700
    DLIFKRPSRQ FQYLHVLLDL SSHEKDKVRS QALLFIKRMY EKEQLREYVE 750
    KFALNYLQLL VHPNPPSVLF GADKDTEVAA PWTEETVKQC LYLYLALLPQ 800
    NHKLIHELAA VYTEAIADIK RTVLRVIEQP IRGMGMNSPE LLLLVENCPK 850
    GAETLVTRCL HSLTDKVPPS PELVKRVRDL YHKRLPDVRF LIPVLNGLEK 900
    KEVIQALPKL IKLNPIVVKE VFNRLLGTQH GEGNSALSPL NPGELLIALH 950
    NIDSVKCDMK SIIKATNLCF AERNVYTSEV LAVVMQQLME QSPLPMLLMR 1000
    TVIQSLTMYP RLGGFVMNIL SRLIMKQVWK YPKVWEGFIK CCQRTKPQSF 1050
    QVILQLPPQQ LGAVFDKCPE LREPLLAHVR SFTPHQQAHI PNSIMTILEA 1100
    SGKQEPEAKE APAGPLEEDD LEPLTLAPAP APRPPQDLIG LRLAQEKALK 1150
    RQLEEEQKLK PGGVGAPSSS SPSPSPSARP GPPPSEEAMD FREEGPECET 1200
    PGIFISMDDD SGLTEAALLD SSLEGPLPKE TAAGGLTLKE ERSPQTLAPV 1250
    GEDAMKTPSP AAEDAREPEA KGNS 1274
    Length:1,274
    Mass (Da):141,148
    Last modified:July 19, 2005 - v2
    Checksum:iD8AD9ABB0B25A688
    GO
    Isoform 2 (identifier: Q92797-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         637-672: GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAP → PRLCWRRHSSQRVPWRWSASTARMRVAPIWACPHFET
         673-1274: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Show »
    Length:673
    Mass (Da):74,523
    Checksum:iE5939FC7FFDAA3AA
    GO

    Sequence cautioni

    The sequence AAH30214.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence CAA71861.1 differs from that shown. Reason: Frameshift at position 67.
    The sequence AAC50667.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAD92261.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei637 – 67236GSLDK…VLEAP → PRLCWRRHSSQRVPWRWSAS TARMRVAPIWACPHFET in isoform 2. 1 PublicationVSP_014842Add
    BLAST
    Alternative sequencei673 – 1274602Missing in isoform 2. 1 PublicationVSP_014843Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y10931 mRNA. Translation: CAA71861.1. Frameshift.
    AB209024 mRNA. Translation: BAD92261.1. Different initiation.
    U88726 mRNA. Translation: AAB58578.1.
    BC006536 mRNA. Translation: AAH06536.2.
    BC006567 mRNA. Translation: AAH06567.2.
    BC030214 mRNA. Translation: AAH30214.1. Sequence problems.
    U49240 mRNA. Translation: AAC50667.1. Different initiation.
    DB328640 mRNA. No translation available.
    CCDSiCCDS12676.2. [Q92797-1]
    RefSeqiNP_004810.2. NM_004819.2. [Q92797-1]
    XP_005259343.1. XM_005259286.1. [Q92797-1]
    UniGeneiHs.515475.

    Genome annotation databases

    EnsembliENST00000245934; ENSP00000245934; ENSG00000125755. [Q92797-1]
    GeneIDi8189.
    KEGGihsa:8189.
    UCSCiuc002pdn.3. human. [Q92797-1]
    uc002pdq.2. human. [Q92797-2]

    Polymorphism databases

    DMDMi71153180.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y10931 mRNA. Translation: CAA71861.1 . Frameshift.
    AB209024 mRNA. Translation: BAD92261.1 . Different initiation.
    U88726 mRNA. Translation: AAB58578.1 .
    BC006536 mRNA. Translation: AAH06536.2 .
    BC006567 mRNA. Translation: AAH06567.2 .
    BC030214 mRNA. Translation: AAH30214.1 . Sequence problems.
    U49240 mRNA. Translation: AAC50667.1 . Different initiation.
    DB328640 mRNA. No translation available.
    CCDSi CCDS12676.2. [Q92797-1 ]
    RefSeqi NP_004810.2. NM_004819.2. [Q92797-1 ]
    XP_005259343.1. XM_005259286.1. [Q92797-1 ]
    UniGenei Hs.515475.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3O2Q X-ray 2.40 A/D 30-360 [» ]
    3O2S X-ray 2.50 A 30-360 [» ]
    3O2T X-ray 1.40 A 30-395 [» ]
    3ODR X-ray 2.20 A 1-395 [» ]
    3ODS X-ray 1.90 A 1-395 [» ]
    4H3H X-ray 2.20 A/D 30-360 [» ]
    4H3K X-ray 2.00 A/D 30-360 [» ]
    ProteinModelPortali Q92797.
    SMRi Q92797. Positions 30-349.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113833. 16 interactions.
    DIPi DIP-42506N.
    IntActi Q92797. 5 interactions.
    MINTi MINT-1537611.
    STRINGi 9606.ENSP00000245934.

    PTM databases

    PhosphoSitei Q92797.

    Polymorphism databases

    DMDMi 71153180.

    Proteomic databases

    MaxQBi Q92797.
    PaxDbi Q92797.
    PRIDEi Q92797.

    Protocols and materials databases

    DNASUi 8189.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000245934 ; ENSP00000245934 ; ENSG00000125755 . [Q92797-1 ]
    GeneIDi 8189.
    KEGGi hsa:8189.
    UCSCi uc002pdn.3. human. [Q92797-1 ]
    uc002pdq.2. human. [Q92797-2 ]

    Organism-specific databases

    CTDi 8189.
    GeneCardsi GC19M046318.
    H-InvDB HIX0015243.
    HGNCi HGNC:22935. SYMPK.
    HPAi HPA041756.
    HPA055661.
    MIMi 602388. gene.
    neXtProti NX_Q92797.
    PharmGKBi PA134896920.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG273943.
    HOGENOMi HOG000046745.
    HOVERGENi HBG062441.
    InParanoidi Q92797.
    KOi K06100.
    OMAi EACKRDN.
    OrthoDBi EOG7RZ5PC.
    PhylomeDBi Q92797.
    TreeFami TF312860.

    Miscellaneous databases

    ChiTaRSi SYMPK. human.
    EvolutionaryTracei Q92797.
    GeneWikii SYMPK.
    GenomeRNAii 8189.
    NextBioi 30878.
    PROi Q92797.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q92797.
    Bgeei Q92797.
    CleanExi HS_SYMPK.
    Genevestigatori Q92797.

    Family and domain databases

    Gene3Di 1.25.10.10. 3 hits.
    InterProi IPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR021850. Symplekin/Pta1.
    IPR022075. Symplekin_C.
    [Graphical view ]
    PANTHERi PTHR15245:SF20. PTHR15245:SF20. 1 hit.
    Pfami PF12295. Symplekin_C. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48371. SSF48371. 3 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Six transcripts map within 200 kilobases of the myotonic dystrophy expanded repeat."
      Alwazzan M., Hamshere M.G., Lennon G.G., Brook J.D.
      Mamm. Genome 9:485-487(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Muscle.
    2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "Chromosomal localization to 19q13.3, partial genomic structure and 5' cDNA sequence of the human symplekin gene."
      Ueki K., Ramaswamy S., Billings S.J., Mohrenweiser H.W., Louis D.N.
      Somat. Cell Mol. Genet. 23:229-231(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-155 (ISOFORM 1).
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-1274 (ISOFORM 1).
      Tissue: Kidney and Lung.
    5. "Symplekin, a novel type of tight junction plaque protein."
      Keon B.H., Schaefer S., Kuhn C., Grund C., Franke W.W.
      J. Cell Biol. 134:1003-1018(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 97-1274 (ISOFORM 1), IDENTIFICATION BY MASS SPECTROMETRY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
      Tissue: Colon carcinoma.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 426-533 (ISOFORM 1).
    7. "Complex protein interactions within the human polyadenylation machinery identify a novel component."
      Takagaki Y., Manley J.L.
      Mol. Cell. Biol. 20:1515-1525(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CSTF2.
    8. "Symplekin, a constitutive protein of karyo- and cytoplasmic particles involved in mRNA biogenesis in Xenopus laevis oocytes."
      Hofmann I., Schnoelzer M., Kaufmann I., Franke W.W.
      Mol. Biol. Cell 13:1665-1676(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    9. "HSF1 modulation of Hsp70 mRNA polyadenylation via interaction with symplekin."
      Xing H., Mayhew C.N., Cullen K.E., Park-Sarge O.-K., Sarge K.D.
      J. Biol. Chem. 279:10551-10555(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HSF1, SUBCELLULAR LOCATION.
    10. "Symplekin and multiple other polyadenylation factors participate in 3'-end maturation of histone mRNAs."
      Kolev N.G., Steitz J.A.
      Genes Dev. 19:2583-2592(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, IDENTIFICATION IN A HEAT-SENSITIVE COMPLEX.
    11. "Conserved motifs in both CPSF73 and CPSF100 are required to assemble the active endonuclease for histone mRNA 3'-end maturation."
      Kolev N.G., Yario T.A., Benson E., Steitz J.A.
      EMBO Rep. 9:1013-1018(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CPSF2 AND CPSF3.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1243; THR-1257 AND SER-1259, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-494, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1243, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex."
      Xiang K., Nagaike T., Xiang S., Kilic T., Beh M.M., Manley J.L., Tong L.
      Nature 467:729-733(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 1-395 IN COMPLEX WITH SSU72, FUNCTION, MUTAGENESIS OF LYS-185, INTERACTION WITH SSU72.
    17. "An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72."
      Xiang K., Manley J.L., Tong L.
      Genes Dev. 26:2265-2270(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 30-360 IN COMPLEX WITH SSU72, INTERACTION WITH SSU72.

    Entry informationi

    Entry nameiSYMPK_HUMAN
    AccessioniPrimary (citable) accession number: Q92797
    Secondary accession number(s): O00521
    , O00689, O00733, Q59GT5, Q8N2U5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: July 19, 2005
    Last modified: October 1, 2014
    This is version 130 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Could be used as a differentiation marker in the differential diagnosis of tumors.

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3