Q92797 (SYMPK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Symplekin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1274 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Scaffold protein that functions as a component of a multimolecular complex involved in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. Is involved in pre-mRNA polyadenylation. Enhances SSU72 phosphatase activity. Ref.10 Ref.16 |
| Subunit structure | Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors. Interacts with CPSF2, CPSF3 and CSTF2. Interacts with HSF1 in heat-stressed cells. Interacts with SSU72. Ref.7 Ref.9 Ref.10 Ref.11 Ref.16 Ref.17 |
| Subcellular location | Cytoplasm › cytoskeleton. Cell junction › tight junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction. Nucleus › nucleoplasm. Note: Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without TJ). Nuclear bodies of heat-stressed cells. Ref.5 Ref.8 Ref.9 |
| Tissue specificity | In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node. Ref.5 |
| Domain | The HEAT repeats have been determined based on 3D-structure analysis of the D.melanogaster ortholog and are not detected by sequence-based prediction programs. |
| Miscellaneous | Could be used as a differentiation marker in the differential diagnosis of tumors. |
| Sequence similarities | Belongs to the Symplekin family. Contains 5 HEAT repeats. |
| Sequence caution | The sequence AAC50667.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH30214.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence BAD92261.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAA71861.1 differs from that shown. Reason: Frameshift at position 67. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion mRNA processing |
| Cellular component | Cell junction Cell membrane Cytoplasm Cytoskeleton Membrane Nucleus Tight junction |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW mRNA polyadenylationInferred from mutant phenotype Ref.16. Source: UniProtKB positive regulation of protein dephosphorylationInferred from direct assay Ref.16. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay Ref.5. Source: UniProtKB cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell nucleoplasmInferred from direct assay Ref.5. Source: UniProtKB plasma membraneInferred from direct assay. Source: HPA tight junctionInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q92797-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92797-2) The sequence of this isoform differs from the canonical sequence as follows: 637-672: GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAP → PRLCWRRHSSQRVPWRWSASTARMRVAPIWACPHFET 673-1274: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1274 | 1274 | Symplekin | PRO_0000072385 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 31 – 64 | 34 | HEAT 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 67 – 101 | 35 | HEAT 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 104 – 146 | 43 | HEAT 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 153 – 192 | 40 | HEAT 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 227 – 266 | 40 | HEAT 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 124 | 124 | Interaction with HSF1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 345 – 360 | 16 | Nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1168 – 1175 | 8 | Poly-Ser | |||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 494 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1243 | 1 | Phosphoserine Ref.12 Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1257 | 1 | Phosphothreonine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1259 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 637 – 672 | 36 | GSLDK…VLEAP → PRLCWRRHSSQRVPWRWSAS TARMRVAPIWACPHFET in isoform 2. | VSP_014842 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 673 – 1274 | 602 | Missing in isoform 2. | VSP_014843 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 185 | 1 | K → A: Abolishes stimulation of SSU72 phosphatase activity. Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 45 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 63 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 67 – 73 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 78 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 79 – 82 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 86 – 102 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 106 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 107 – 118 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 123 – 146 | 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 170 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 171 – 173 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 177 – 193 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 205 – 207 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 213 – 215 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 221 – 223 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 242 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 266 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 270 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 271 – 283 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 289 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 293 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 294 – 309 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 317 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 318 – 327 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 332 – 337 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 342 – 345 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Six transcripts map within 200 kilobases of the myotonic dystrophy expanded repeat." Alwazzan M., Hamshere M.G., Lennon G.G., Brook J.D. Mamm. Genome 9:485-487(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Muscle. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Chromosomal localization to 19q13.3, partial genomic structure and 5' cDNA sequence of the human symplekin gene." Ueki K., Ramaswamy S., Billings S.J., Mohrenweiser H.W., Louis D.N. Somat. Cell Mol. Genet. 23:229-231(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-155 (ISOFORM 1). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-1274 (ISOFORM 1). Tissue: Kidney and Lung. |
| [5] | "Symplekin, a novel type of tight junction plaque protein." Keon B.H., Schaefer S., Kuhn C., Grund C., Franke W.W. J. Cell Biol. 134:1003-1018(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 97-1274 (ISOFORM 1), IDENTIFICATION BY MASS SPECTROMETRY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. Tissue: Colon carcinoma. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 426-533 (ISOFORM 1). |
| [7] | "Complex protein interactions within the human polyadenylation machinery identify a novel component." Takagaki Y., Manley J.L. Mol. Cell. Biol. 20:1515-1525(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CSTF2. |
| [8] | "Symplekin, a constitutive protein of karyo- and cytoplasmic particles involved in mRNA biogenesis in Xenopus laevis oocytes." Hofmann I., Schnoelzer M., Kaufmann I., Franke W.W. Mol. Biol. Cell 13:1665-1676(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "HSF1 modulation of Hsp70 mRNA polyadenylation via interaction with symplekin." Xing H., Mayhew C.N., Cullen K.E., Park-Sarge O.-K., Sarge K.D. J. Biol. Chem. 279:10551-10555(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HSF1, SUBCELLULAR LOCATION. |
| [10] | "Symplekin and multiple other polyadenylation factors participate in 3'-end maturation of histone mRNAs." Kolev N.G., Steitz J.A. Genes Dev. 19:2583-2592(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A HEAT-SENSITIVE COMPLEX. |
| [11] | "Conserved motifs in both CPSF73 and CPSF100 are required to assemble the active endonuclease for histone mRNA 3'-end maturation." Kolev N.G., Yario T.A., Benson E., Steitz J.A. EMBO Rep. 9:1013-1018(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CPSF2 AND CPSF3. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1243; THR-1257 AND SER-1259, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-494, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1243, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex." Xiang K., Nagaike T., Xiang S., Kilic T., Beh M.M., Manley J.L., Tong L. Nature 467:729-733(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 1-395 IN COMPLEX WITH SSU72, FUNCTION, MUTAGENESIS OF LYS-185, INTERACTION WITH SSU72. |
| [17] | "An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72." Xiang K., Manley J.L., Tong L. Genes Dev. 26:2265-2270(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 30-360 IN COMPLEX WITH SSU72, INTERACTION WITH SSU72. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y10931 mRNA. Translation: CAA71861.1. Frameshift. AB209024 mRNA. Translation: BAD92261.1. Different initiation. U88726 mRNA. Translation: AAB58578.1. BC006536 mRNA. Translation: AAH06536.2. BC006567 mRNA. Translation: AAH06567.2. BC030214 mRNA. Translation: AAH30214.1. Sequence problems. U49240 mRNA. Translation: AAC50667.1. Different initiation. DB328640 mRNA. No translation available. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00023344. IPI00413614. IPI00556574. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_004810.2. NM_004819.2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.515475. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-42506N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1537611. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000245934. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 71153180. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 8189. | ||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000245934; ENSP00000245934; ENSG00000125755. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 8189. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:8189. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002pdn.3. human. uc002pdq.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 8189. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC19M046318. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0015243. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:22935. SYMPK. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA041756. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602388. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134896920. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG273943. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000046745. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG062441. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K06100. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | EACKRDN. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4C2H8Q. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SYMPK. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000125755. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.25.10.10. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR021850. DUF3453. IPR022075. Symplekin_C. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF11935. DUF3453. 1 hit. PF12295. Symplekin_C. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50077. HEAT_REPEAT. False negative. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | SYMPK. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q92797. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 8189. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 30878. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SYMPK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92797 Secondary accession number(s): O00521 Q8N2U5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
