Q92793 (CBP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 166.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CREB-binding protein EC=2.3.1.48 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2442 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like NCOA3 and FOXO1. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1 in the presence of EP300. Ref.11 Ref.17 Ref.27 Ref.29 |
| Catalytic activity | Acetyl-CoA + [histone] = CoA + acetyl-[histone]. |
| Subunit structure | Found in a complex containing NCOA2; NCOA3; IKKA; IKKB and IKBKG. Probably part of a complex with HIF1A and EP300. Interacts with GATA1; the interaction results in acetylation and enhancement of transcriptional activity of GATA1. Interacts with MAF AND ZCCHC12. Interacts with DAXX; the interaction is dependent on CBP sumoylation and results in suppression of the transcriptional activiy via recruitment of HDAC2 to DAAX By similarity. Interacts with phosphorylated CREB1. Interacts with CITED4 (C-terminal region). Interacts (via the TAZ-type 1 domain) with HIF1A. Interacts with SRCAP, CARM1, ELF3, MLLT7/FOXO4, N4BP2, NCOA1, NCOA3, NCOA6, PCAF, DDX5, DDX17, PELP1, PML, SMAD1, SMAD2, SMAD3, SPIB and TRERF1. Interacts with HTLV-1 Tax and p30II. Interacts with HIV-1 Tat. Interacts with KLF1; the interaction results in acetylation of KLF1 and enhancement of its transcriptional activity. Interacts with MTDH. Interacts with NFATC4. Interacts with MAFG; the interaction acetylates MAFG in the basic region and stimulates NFE2 transcriptional activity through increasing its DNA-binding activity. Interacts with IRF2; the interaction acetylates IRF2 and regulates its activity on the H4 promoter. Interacts (via N-terminus) with SS18L1/CREST (via C-terminus). Interacts with MECOM. Interacts with CITED1 (via C-terminus). Interacts with FOXO1; the interaction acetylates FOXO1 and inhibits its transcriptional activity. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 Ref.23 Ref.24 Ref.25 Ref.26 Ref.27 Ref.28 Ref.30 Ref.31 Ref.33 Ref.34 Ref.37 |
| Subcellular location | Cytoplasm. Nucleus. Note: Recruited to nuclear bodies by SS18L1/CREST. In the presence of ALX1 relocalizes from the cytoplasm to the nucleus. Ref.29 Ref.32 |
| Domain | The KIX domain mediates binding to HIV-1 Tat. |
| Post-translational modification | Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response By similarity. Phosphorylated by CHUK/IKKA at Ser-1382 and Ser-1386; these phosphorylations promote cell growth by switching the binding preference of CREBBP from TP53 to NF-kappa-B. Ref.35 Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX By similarity. |
| Involvement in disease | Chromosomal aberrations involving CREBBP may be a cause of acute myeloid leukemias. Translocation t(8;16)(p11;p13) with KAT6A; translocation t(11;16)(q23;p13.3) with MLL/HRX; translocation t(10;16)(q22;p13) with KAT6B. KAT6A-CREBBP may induce leukemia by inhibiting RUNX1-mediated transcription. Rubinstein-Taybi syndrome 1 (RSTS1) [MIM:180849]: A disorder characterized by craniofacial abnormalities, postnatal growth deficiency, broad thumbs, broad big toes, mental retardation and a propensity for development of malignancies. |
| Sequence similarities | Contains 1 bromo domain. Contains 1 KIX domain. Contains 2 TAZ-type zinc fingers. Contains 1 ZZ-type zinc finger. |
| Sequence caution | The sequence BAE06125.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AR | P10275 | 2 | EBI-81215,EBI-608057 | |
| DAXX | Q9UER7 | 2 | EBI-81215,EBI-77321 | |
| FOXO1 | Q12778 | 2 | EBI-81215,EBI-1108782 | |
| IFNAR2 | P48551 | 4 | EBI-81215,EBI-958408 | |
| IRF3 | Q14653 | 3 | EBI-81215,EBI-2650369 | |
| KAT2B | Q92831 | 3 | EBI-81215,EBI-477430 | |
| MTDH | Q86UE4 | 2 | EBI-81215,EBI-1046588 | |
| NAP1L1 | P55209 | 3 | EBI-81215,EBI-356392 | |
| NCOA6 | Q14686 | 2 | EBI-81215,EBI-78670 | |
| RELA | Q04206 | 3 | EBI-81215,EBI-73886 | |
| TP53 | P04637 | 6 | EBI-81215,EBI-366083 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92793-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92793-2) The sequence of this isoform differs from the canonical sequence as follows: 406-444: VAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQT → A | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2442 | 2442 | CREB-binding protein | PRO_0000211190 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 587 – 666 | 80 | KIX | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1103 – 1175 | 73 | Bromo | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 347 – 433 | 87 | TAZ-type 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 1701 – 1744 | 44 | ZZ-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 1765 – 1846 | 82 | TAZ-type 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 227 – 410 | 184 | Interaction with SRCAP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1460 – 1891 | 432 | Interaction with TRERF1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1061 – 1064 | 4 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1199 – 1487 | 289 | Cys/His-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1555 – 1562 | 8 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1943 – 1948 | 6 | Poly-Pro | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1967 – 1970 | 4 | Poly-Gln | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 2081 – 2085 | 5 | Poly-Gln | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 2199 – 2216 | 18 | Poly-Gln | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 2245 – 2248 | 4 | Poly-Gln | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 2297 – 2300 | 4 | Poly-Gln | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 363 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 367 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 380 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 385 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 394 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 398 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 404 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 409 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 418 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 422 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 427 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 430 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 29 – 30 | 2 | Breakpoint for translocation to form KAT6B-CREBBP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 266 – 267 | 2 | Breakpoint for translocation to form KAT6A-CREBBP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 121 | 1 | Phosphoserine Ref.38 Ref.41 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 601 | 1 | Omega-N-methylated arginine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 625 | 1 | Omega-N-methylated arginine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1014 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1030 | 1 | Phosphoserine Ref.36 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1216 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1382 | 1 | Phosphoserine; by IKKA Ref.35 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1386 | 1 | Phosphoserine; by IKKA Ref.35 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1583 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1586 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1591 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1592 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1595 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1597 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1741 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1744 | 1 | N6-acetyllysine Ref.40 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2063 | 1 | Phosphoserine Ref.38 Ref.39 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2076 | 1 | Phosphoserine Ref.38 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2079 | 1 | Phosphoserine Ref.38 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 998 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 1033 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 1056 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 406 – 444 | 39 | VAHCA…RNQQT → A in isoform 2. | VSP_045700 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1175 | 1 | Y → C in RSTS1; mild form. Ref.48 Corresponds to variant rs28937315 [ dbSNP | Ensembl ]. | VAR_037305 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1278 | 1 | E → K in RSTS1; abolishes acetyltransferase activity. Ref.49 Ref.50 | VAR_035080 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1378 | 1 | R → P in RSTS1; abolishes acetyltransferase activity and the ability of transactivate CREB. Ref.47 | VAR_015578 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1414 | 1 | V → I. Corresponds to variant rs130015 [ dbSNP | Ensembl ]. | VAR_027953 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1447 | 1 | T → I in RSTS1. Ref.50 | VAR_035081 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1450 | 1 | Y → H in RSTS1. Ref.50 | VAR_035082 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1470 | 1 | H → R in RSTS1. Ref.50 | VAR_035083 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1664 | 1 | R → H in RSTS1; abolishes acetyltransferase activity. Ref.49 Ref.50 | VAR_035084 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1511 – 1513 | 3 | FAE → NSG in AAC51340. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1724 – 1725 | 2 | ED → VV in AAC51340. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1770 | 1 | L → V in AAC51770. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1789 | 1 | N → F in AAC51340. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1812 | 1 | T → P in AAC51340. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 135 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 377 – 379 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 383 – 388 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 391 – 395 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 593 – 596 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 598 – 612 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 618 – 622 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 624 – 642 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 647 – 669 | 23 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 670 – 672 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1087 – 1102 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1105 – 1108 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1109 – 1111 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1117 – 1120 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1125 – 1128 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1135 – 1143 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1146 – 1149 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1150 – 1167 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1169 – 1171 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1173 – 1196 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1765 – 1784 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1793 – 1805 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1811 – 1815 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1817 – 1832 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1841 – 1853 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 2066 – 2072 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 2080 – 2091 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 2094 – 2103 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 2104 – 2106 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MLL is fused to CBP, a histone acetyltransferase, in therapy-related acute myeloid leukemia with a t(11;16)(q23;p13.3)." Sobulo O.M., Borrow J., Tomek R., Reshimi S., Harden A., Schlegelberger B., Housman D., Doggett N.A., Rowley J.D., Zeleznik-Le N.J. Proc. Natl. Acad. Sci. U.S.A. 94:8732-8737(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "Construction of a 1.2-Mb contig surrounding, and molecular analysis of, the human CREB-binding protein (CBP/CREBBP) gene on chromosome 16p13.3." Giles R.H., Petrij F., Dauwerse H.G., den Hollander A.I., Lushnikova T., van Ommen G.J.B., Goodman R.H., Deaven L.L., Doggett N.A., Peters D.J.M., Breuning M.H. Genomics 42:96-114(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | Petrij F., den Hollander A.I., Chrivia J.C. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 1724-1725; 1789 AND 1812. |
| [4] | "Preparation of a set of expression-ready clones of mammalian long cDNAs encoding large proteins by the ORF trap cloning method." Nakajima D., Saito K., Yamakawa H., Kikuno R.F., Nakayama M., Ohara R., Okazaki N., Koga H., Nagase T., Ohara O. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The translocation t(8;16)(p11;p13) of acute myeloid leukaemia fuses a putative acetyltransferase to the CREB-binding protein." Borrow J., Stanton V.P. Jr., Andresen J.M., Becher R., Behm F.G., Chaganti R.S.K., Civin C.I., Disteche C., Dube I., Frischauf A.M., Horsman D., Mitelman F., Volinia S., Watmore A.E., Housman D.E. Nat. Genet. 14:33-41(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-405, CHROMOSOMAL TRANSLOCATION WITH KAT6A. |
| [7] | "Fusion of the MORF and CBP genes in acute myeloid leukemia with the t(10;16)(q22;p13)." Panagopoulos I., Fioretos T., Isaksson M., Samuelsson U., Billstroem R., Stroembeck B., Mitelman F., Johansson B. Hum. Mol. Genet. 10:395-404(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-83, CHROMOSOMAL TRANSLOCATION WITH KAT6B. |
| [8] | "A p300/CBP-associated factor that competes with the adenoviral oncoprotein E1A." Yang X.-J., Ogryzko V.V., Nishikawa J., Howard B.H., Nakatani Y. Nature 382:319-324(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PCAF. |
| [9] | "An essential role for p300/CBP in the cellular response to hypoxia." Arany Z., Huang L.E., Eckner R., Bhattacharya S., Jiang C., Goldberg M.A., Bunn H.F., Livingston D.M. Proc. Natl. Acad. Sci. U.S.A. 93:12969-12973(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HIF1A AND EP300. |
| [10] | "Differential transcriptional activation by human T-cell leukemia virus type 1 Tax mutants is mediated by distinct interactions with CREB binding protein and p300." Bex F., Yin M.-J., Burny A., Gaynor R.B. Mol. Cell. Biol. 18:2392-2405(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTLV-1 TAX. |
| [11] | "Acetylation and modulation of erythroid Krueppel-like factor (EKLF) activity by interaction with histone acetyltransferases." Zhang W., Bieker J.J. Proc. Natl. Acad. Sci. U.S.A. 95:9855-9860(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KLF1, FUNCTION. |
| [12] | "Identification of a novel SNF2/SWI2 protein family member, SRCAP, which interacts with CREB-binding protein." Johnston H., Kneer J., Chackalaparampil I., Yaciuk P., Chrivia J. J. Biol. Chem. 274:16370-16376(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SRCAP. |
| [13] | "Modulation of CREB binding protein function by the promyelocytic (PML) oncoprotein suggests a role for nuclear bodies in hormone signaling." Doucas V., Tini M., Egan D.A., Evans R.M. Proc. Natl. Acad. Sci. U.S.A. 96:2627-2632(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PML. |
| [14] | "Regulation of hormone-induced histone hyperacetylation and gene activation via acetylation of an acetylase." Chen H., Lin R.J., Xie W., Wilpitz D., Evans R.M. Cell 98:675-686(1999) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION OF NCOA3. |
| [15] | "The MSG1 non-DNA-binding transactivator binds to the p300/CBP coactivators, enhancing their functional link to the Smad transcription factors." Yahata T., de Caestecker M.P., Lechleider R.J., Andriole S., Roberts A.B., Isselbacher K.J., Shioda T. J. Biol. Chem. 275:8825-8834(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CITED1. |
| [16] | "A new family of nuclear receptor coregulators that integrates nuclear receptor signaling through CBP." Mahajan M.A., Samuels H.H. Mol. Cell. Biol. 20:5048-5063(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NCOA6. |
| [17] | "Stimulation of NF-E2 DNA binding by CREB-binding protein (CBP)-mediated acetylation." Hung H.-L., Kim A.Y., Hong W., Rakowski C., Blobel G.A. J. Biol. Chem. 276:10715-10721(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAFG, FUNCTION IN ACETYLATION OF MAFG. |
| [18] | "Requirement of two NFATc4 transactivation domains for CBP potentiation." Yang T.T.C., Davis R.J., Chow C.-W. J. Biol. Chem. 276:39569-39576(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NFATC4. |
| [19] | "Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles." Chakraborty S., Senyuk V., Sitailo S., Chi Y., Nucifora G. J. Biol. Chem. 276:44936-44943(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MECOM. |
| [20] | "The oncoprotein Tax binds the SRC-1-interacting domain of CBP/p300 to mediate transcriptional activation." Scoggin K.E.S., Ulloa A., Nyborg J.K. Mol. Cell. Biol. 21:5520-5530(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTLV-1 TAX. |
| [21] | "Human T-lymphotropic virus type 1 p30(II) regulates gene transcription by binding CREB binding protein/p300." Zhang W., Nisbet J.W., Albrecht B., Ding W., Kashanchi F., Bartoe J.T., Lairmore M.D. J. Virol. 75:9885-9895(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTLV-1 ACCESSORY PROTEIN P30II. |
| [22] | "A novel zinc finger protein TReP-132 interacts with CBP/p300 to regulate human CYP11A1 gene expression." Gizard F., Lavallee B., DeWitte F., Hum D.W. J. Biol. Chem. 276:33881-33892(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRERF1. |
| [23] | "Molecular cloning and characterization of PELP1, a novel human coregulator of estrogen receptor alpha." Vadlamudi R.K., Wang R.-A., Mazumdar A., Kim Y.-S., Shin J., Sahin A., Kumar R. J. Biol. Chem. 276:38272-38279(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PELP1. |
| [24] | "Interaction between the hematopoietic Ets transcription factor Spi-B and the coactivator CREB-binding protein associated with negative cross-talk with c-Myb." Yamamoto H., Kihara-Negishi F., Yamada T., Suzuki M., Nakano T., Oikawa T. Cell Growth Differ. 13:69-75(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SPIB. |
| [25] | "Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2." Braganca J., Swingler T., Marques F.I.R., Jones T., Eloranta J.J., Hurst H.C., Shioda T., Bhattacharya S. J. Biol. Chem. 277:8559-8565(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CITED4. |
| [26] | "Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) coactivator activity by I kappa B kinase." Wu R.-C., Qin J., Hashimoto Y., Wong J., Xu J., Tsai S.Y., Tsai M.-J., O'Malley B.W. Mol. Cell. Biol. 22:3549-3561(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH NCOA2; NCOA3; IKKA; IKKB AND IKBKG. |
| [27] | "Interferon regulatory factor-2 regulates cell growth through its acetylation." Masumi A., Yamakawa Y., Fukazawa H., Ozato K., Komuro K. J. Biol. Chem. 278:25401-25407(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IRF2, FUNCTION IN ACETYLATION OF IRF2. |
| [28] | "Identification and characterization of BCL-3-binding protein: implications for transcription and DNA repair or recombination." Watanabe N., Wachi S., Fujita T. J. Biol. Chem. 278:26102-26110(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH N4BP2. |
| [29] | "P300/CBP acts as a coactivator to cartilage homeoprotein-1 (Cart1), paired-like homeoprotein, through acetylation of the conserved lysine residue adjacent to the homeodomain." Iioka T., Furukawa K., Yamaguchi A., Shindo H., Yamashita S., Tsukazaki T. J. Bone Miner. Res. 18:1419-1429(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [30] | "Positive and negative modulation of the transcriptional activity of the ETS factor ESE-1 through interaction with p300, CREB-binding protein, and Ku 70/86." Wang H., Fang R., Cho J.-Y., Libermann T.A., Oettgen P. J. Biol. Chem. 279:25241-25250(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ELF3. |
| [31] | "FOXO4 is acetylated upon peroxide stress and deacetylated by the longevity protein hSir2(SIRT1)." van der Horst A., Tertoolen L.G.J., de Vries-Smits L.M.M., Frye R.A., Medema R.H., Burgering B.M.T. J. Biol. Chem. 279:28873-28879(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MLLT7. |
| [32] | "The calcium-responsive transactivator recruits CREB binding protein to nuclear bodies." Pradhan A., Liu Y. Neurosci. Lett. 370:191-195(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [33] | "Silent information regulator 2 potentiates Foxo1-mediated transcription through its deacetylase activity." Daitoku H., Hatta M., Matsuzaki H., Aratani S., Ohshima T., Miyagishi M., Nakajima T., Fukamizu A. Proc. Natl. Acad. Sci. U.S.A. 101:10042-10047(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FOXO1. |
| [34] | "Dendrite development regulated by CREST, a calcium-regulated transcriptional activator." Aizawa H., Hu S.-C., Bobb K., Balakrishnan K., Ince G., Gurevich I., Cowan M., Ghosh A. Science 303:197-202(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SS18L1/CREST. |
| [35] | "Phosphorylation of CBP by IKKalpha promotes cell growth by switching the binding preference of CBP from p53 to NF-kappaB." Huang W.C., Ju T.K., Hung M.C., Chen C.C. Mol. Cell 26:75-87(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-1382 AND SER-1386 BY CHUK/IKKA. |
| [36] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1030, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [37] | "Molecular basis of nuclear factor-kappaB activation by astrocyte elevated gene-1." Sarkar D., Park E.S., Emdad L., Lee S.-G., Su Z.-Z., Fisher P.B. Cancer Res. 68:1478-1484(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MTDH. |
| [38] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-121; SER-2063; SER-2076 AND SER-2079, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [39] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2063, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [40] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1014; LYS-1216; LYS-1583; LYS-1586; LYS-1591; LYS-1592; LYS-1595; LYS-1597; LYS-1741 AND LYS-1744, MASS SPECTROMETRY. |
| [41] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-121, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [42] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [43] | "Structural basis for Hif-1 alpha /CBP recognition in the cellular hypoxic response." Dames S.A., Martinez-Yamout M., De Guzman R.N., Dyson H.J., Wright P.E. Proc. Natl. Acad. Sci. U.S.A. 99:5271-5276(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 345-439 IN COMPLEX WITH 776-826 OF HIF1A. |
| [44] | "Activation of AML1-mediated transcription by MOZ and inhibition by the MOZ-CBP fusion protein." Kitabayashi I., Aikawa Y., Nguyen L.A., Yokoyama A., Ohki M. EMBO J. 20:7184-7196(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH KAT6A. |
| [45] | "NMR mapping of the HIV-1 Tat interaction surface of the KIX domain of the human coactivator CBP." Vendel A.C., Lumb K.J. Biochemistry 43:904-908(2004) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 589-679 IN COMPLEX WITH HIV-1 TAT. |
| [46] | "Histone recognition and large-scale structural analysis of the human bromodomain family." Filippakopoulos P., Picaud S., Mangos M., Keates T., Lambert J.P., Barsyte-Lovejoy D., Felletar I., Volkmer R., Muller S., Pawson T., Gingras A.C., Arrowsmith C.H., Knapp S. Cell 149:214-231(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1081-1197. |
| [47] | "Defect of histone acetyltransferase activity of the nuclear transcriptional coactivator CBP in Rubinstein-Taybi syndrome." Murata T., Kurokawa R., Krones A., Tatsumi K., Ishii M., Taki T., Masuno M., Ohashi H., Yanagisawa M., Rosenfeld M.G., Glass C.K., Hayashi Y. Hum. Mol. Genet. 10:1071-1076(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RSTS1 PRO-1378. |
| [48] | "Molecular studies in 10 cases of Rubinstein-Taybi syndrome, including a mild variant showing a missense mutation in codon 1175 of CREBBP." Bartsch O., Locher K., Meinecke P., Kress W., Seemanova E., Wagner A., Ostermann K., Roedel G. J. Med. Genet. 39:496-501(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RSTS1 CYS-1175. |
| [49] | "Loss of CBP acetyltransferase activity by PHD finger mutations in Rubinstein-Taybi syndrome." Kalkhoven E., Roelfsema J.H., Teunissen H., den Boer A., Ariyuerek Y., Zantema A., Breuning M.H., Hennekam R.C.M., Peters D.J.M. Hum. Mol. Genet. 12:441-450(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RSTS1 LYS-1278 AND HIS-1664, CHARACTERIZATION OF VARIANTS RSTS1 LYS-1278 AND HIS-1664. |
| [50] | "Genetic heterogeneity in Rubinstein-Taybi syndrome: mutations in both the CBP and EP300 genes cause disease." Roelfsema J.H., White S.J., Ariyuerek Y., Bartholdi D., Niedrist D., Papadia F., Bacino C.A., den Dunnen J.T., van Ommen G.-J.B., Breuning M.H., Hennekam R.C., Peters D.J.M. Am. J. Hum. Genet. 76:572-580(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RSTS1 LYS-1278; ILE-1447; HIS-1450; ARG-1470 AND HIS-1664. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U85962 mRNA. Translation: AAC51331.2. U89354 mRNA. Translation: AAC51339.1. U89355 mRNA. Translation: AAC51340.1. U47741 mRNA. Translation: AAC51770.1. AB210043 mRNA. Translation: BAE06125.1. Different initiation. CH471112 Genomic DNA. Translation: EAW85335.1. CH471112 Genomic DNA. Translation: EAW85336.1. CH471112 Genomic DNA. Translation: EAW85337.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00023339. IPI01009314. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S39162. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001073315.1. NM_001079846.1. NP_004371.2. NM_004380.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.459759. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-952N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q92793. 42 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-104685. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000262367. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 116241283. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000262367; ENSP00000262367; ENSG00000005339. ENST00000382070; ENSP00000371502; ENSG00000005339. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 1387. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:1387. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002cvv.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 1387. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC16M003775. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:2348. CREBBP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004212. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 180849. phenotype. 600140. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 783. Rubinstein-Taybi syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA26866. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5076. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000111353. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000185. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04498. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4B2SW9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | wnt_canonical_pathway. Canonical Wnt signaling pathway. pi3kciaktpathway. Class I PI3K signaling events mediated by Akt. hnf3apathway. FOXA1 transcription factor network. foxm1pathway. FOXM1 transcription factor network. foxopathway. FoxO family signaling. hedgehog_glipathway. Hedgehog signaling events mediated by Gli proteins. hif1_tfpathway. HIF-1-alpha transcription factor network. ifngpathway. IFN-gamma pathway. il12_stat4pathway. IL12 signaling mediated by STAT4. ps1pathway. Presenilin action in Notch and Wnt signaling. ar_tf_pathway. Regulation of Androgen receptor activity. smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. retinoic_acid_pathway. Retinoic acid receptors-mediated signaling. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. hdac_classi_pathway. Signaling events mediated by HDAC Class I. hdac_classiii_pathway. Signaling events mediated by HDAC Class III. kitpathway. Signaling events mediated by Stem cell factor receptor (c-Kit). | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_111217. Metabolism. REACT_120956. Cellular responses to stress. REACT_2155. NICD traffics to nucleus. REACT_6900. Immune System. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_CREBBP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000005339. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.1630.10. 1 hit. 1.10.246.20. 1 hit. 1.20.1020.10. 2 hits. 1.20.920.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001487. Bromodomain. IPR018359. Bromodomain_CS. IPR010303. DUF902_CREBbp. IPR013178. Histone_H3-K56_AcTrfase_RTT109. IPR003101. KIX_dom. IPR009110. Nuc_rcpt_coact. IPR014744. Nuc_rcpt_coact_CREBbp. IPR000197. Znf_TAZ. IPR000433. Znf_ZZ. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00439. Bromodomain. 1 hit. PF09030. Creb_binding. 1 hit. PF06001. DUF902. 1 hit. PF08214. KAT11. 1 hit. PF02172. KIX. 1 hit. PF02135. zf-TAZ. 2 hits. PF00569. ZZ. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00503. BROMODOMAIN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00297. BROMO. 1 hit. SM00551. ZnF_TAZ. 2 hits. SM00291. ZnF_ZZ. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47370. Bromodomain. 1 hit. SSF47040. KIX. 1 hit. SSF69125. Nuc_recept_coact. 1 hit. SSF57933. TAZ_finger. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00633. BROMODOMAIN_1. 1 hit. PS50014. BROMODOMAIN_2. 1 hit. PS50952. KIX. 1 hit. PS50134. ZF_TAZ. 2 hits. PS01357. ZF_ZZ_1. 1 hit. PS50135. ZF_ZZ_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | CREBBP. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q92793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 1387. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 5635. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CBP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92793 Secondary accession number(s): D3DUC9 Q4LE28 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
