Q92782 (DPF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein neuro-d4 Alternative name(s): BRG1-associated factor 45B Short name=BAF45B D4, zinc and double PHD fingers family 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 380 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth By similarity. |
| Subunit structure | Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the requiem/DPF family. Contains 2 PHD-type zinc fingers. |
| Caution | It is uncertain whether Met-1 or Met-28 is the initiator. |
| Sequence caution | The sequence AAC50685.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI25154.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence EAW56763.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Neurogenesis Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | induction of apoptosis Traceable author statement. Source: ProtInc nervous system developmentInferred from sequence or structural similarity. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nBAF complexInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q92782-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92782-2) The sequence of this isoform differs from the canonical sequence as follows: 226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ 321-330: Missing. | ||||||
| Isoform 3 (identifier: Q92782-3) The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. 226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ 321-330: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 380 | 380 | Zinc finger protein neuro-d4 | PRO_0000168145 | |||||
Regions | |||||||||
| Zinc finger | 254 – 311 | 58 | PHD-type 1 | ||||||
| Zinc finger | 308 – 368 | 61 | PHD-type 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 82 | 82 | Missing in isoform 3. | VSP_040224 | |||||
| Alternative sequence | 226 | 1 | K → ICGKRYKNRPGLSYHYTHTH LAEEEGEENAERHALPFHRK NNHKQ in isoform 2 and isoform 3. | VSP_040225 | |||||
| Alternative sequence | 321 – 330 | 10 | Missing in isoform 2 and isoform 3. | VSP_040226 | |||||
Experimental info | |||||||||
| Sequence conflict | 25 | 1 | G → T in AAI25154. Ref.4 | ||||||
| Sequence conflict | 34 | 1 | G → S in AAC50685. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK094632 mRNA. Translation: BAG52900.1. DA076421 mRNA. No translation available. AC011479 Genomic DNA. No translation available. CH471126 Genomic DNA. Translation: EAW56763.1. Sequence problems. BC125153 mRNA. Translation: AAI25154.1. Different initiation. U43843 mRNA. Translation: AAC50685.1. Different initiation. |
| IPI | IPI00216452. IPI00291761. IPI00642063. |
| RefSeq | NP_001128627.1. NM_001135155.1. NP_001128628.1. NM_001135156.1. NP_004638.2. NM_004647.2. |
| UniGene | Hs.631576. |
3D structure databases | |
| ProteinModelPortal | Q92782. |
| SMR | Q92782. Positions 256-374. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q92782. 1 interaction. |
| MINT | MINT-4302537. |
| STRING | Q92782. |
PTM databases | |
| PhosphoSite | Q92782. |
Polymorphism databases | |
| DMDM | 2500145. |
Proteomic databases | |
| PRIDE | Q92782. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355526; ENSP00000347716; ENSG00000011332. ENST00000412732; ENSP00000412098; ENSG00000011332. ENST00000414789; ENSP00000391884; ENSG00000011332. ENST00000420980; ENSP00000397354; ENSG00000011332. ENST00000434076; ENSP00000413691; ENSG00000011332. ENST00000437720; ENSP00000394981; ENSG00000011332. ENST00000444314; ENSP00000400336; ENSG00000011332. ENST00000456296; ENSP00000411569; ENSG00000011332. |
| GeneID | 8193. |
| KEGG | hsa:8193. |
| UCSC | uc002ohl.1. human. |
Organism-specific databases | |
| CTD | 8193. |
| GeneCards | GC19M038701. |
| HGNC | HGNC:20225. DPF1. |
| MIM | 601670. gene. |
| neXtProt | NX_Q92782. |
| PharmGKB | PA134879894. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00530000063194. |
| HOVERGEN | HBG004475. |
| InParanoid | Q92782. |
| OMA | CEYKIDC. |
| OrthoDB | EOG4T4CX1. |
Gene expression databases | |
| ArrayExpress | Q92782. |
| Bgee | Q92782. |
| CleanEx | HS_DPF1. |
| Genevestigator | Q92782. |
| GermOnline | ENSG00000011332. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011011. Znf_FYVE_PHD. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Gene3D | G3DSA:3.30.40.10. Znf_RING/FYVE/PHD. 2 hits. |
| Pfam | PF00628. PHD. 1 hit. [Graphical view] |
| SMART | SM00249. PHD. 2 hits. SM00184. RING. 2 hits. [Graphical view] |
| SUPFAM | SSF57903. FYVE_PHD_ZnF. 1 hit. |
| PROSITE | PS01359. ZF_PHD_1. 1 hit. PS50016. ZF_PHD_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 30890. |
| SOURCE | Search... |
Entry information
| Entry name | DPF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92782 Secondary accession number(s): B3KSY8, Q08AJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with