Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein neuro-d4

Gene

DPF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).By similarity

Caution

It is uncertain whether Met-1 or Met-28 is the initiator.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri254 – 311PHD-type 1PROSITE-ProRule annotationAdd BLAST58
Zinc fingeri308 – 368PHD-type 2PROSITE-ProRule annotationAdd BLAST61

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processNeurogenesis, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein neuro-d4
Alternative name(s):
BRG1-associated factor 45B
Short name:
BAF45B
D4, zinc and double PHD fingers family 1
Gene namesi
Name:DPF1
Synonyms:BAF45B, NEUD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000011332.19
HGNCiHGNC:20225 DPF1
MIMi601670 gene
neXtProtiNX_Q92782

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000011332
PharmGKBiPA134879894

Polymorphism and mutation databases

BioMutaiDPF1
DMDMi313104100

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001681451 – 380Zinc finger protein neuro-d4Add BLAST380

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki133Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki156Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki160Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ92782
PeptideAtlasiQ92782
PRIDEiQ92782

PTM databases

iPTMnetiQ92782
PhosphoSitePlusiQ92782
SwissPalmiQ92782

Expressioni

Gene expression databases

BgeeiENSG00000011332
CleanExiHS_DPF1
ExpressionAtlasiQ92782 baseline and differential
GenevisibleiQ92782 HS

Organism-specific databases

HPAiHPA049148

Interactioni

Subunit structurei

Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin.By similarity

Protein-protein interaction databases

BioGridi113836, 13 interactors
IntActiQ92782, 3 interactors

Structurei

3D structure databases

ProteinModelPortaliQ92782
SMRiQ92782
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the requiem/DPF family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri254 – 311PHD-type 1PROSITE-ProRule annotationAdd BLAST58
Zinc fingeri308 – 368PHD-type 2PROSITE-ProRule annotationAdd BLAST61

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00910000144012
HOGENOMiHOG000217918
HOVERGENiHBG004475
InParanoidiQ92782
KOiK22198
OMAiRLRPCEF
OrthoDBiEOG091G0XBM
PhylomeDBiQ92782

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR038046 DPF1
IPR025750 Requiem/DPF_N_dom
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR10615:SF12 PTHR10615:SF12, 2 hits
PfamiView protein in Pfam
PF00628 PHD, 1 hit
PF14051 Requiem_N, 1 hit
SMARTiView protein in SMART
SM00249 PHD, 2 hits
SUPFAMiSSF57903 SSF57903, 2 hits
PROSITEiView protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q92782-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGLSARPTA GRTDPAGTCW GQDPGSKMAT VIPGPLSLGE DFYREAIEHC
60 70 80 90 100
RSYNARLCAE RSLRLPFLDS QTGVAQNNCY IWMEKTHRGP GLAPGQIYTY
110 120 130 140 150
PARCWRKKRR LNILEDPRLR PCEYKIDCEA PLKKEGGLPE GPVLEALLCA
160 170 180 190 200
ETGEKKIELK EEETIMDCQK QQLLEFPHDL EVEDLEDDIP RRKNRAKGKA
210 220 230 240 250
YGIGGLRKRQ DTASLEDRDK PYVCDKFYKE LAWVPEAQRK HTAKKAPDGT
260 270 280 290 300
VIPNGYCDFC LGGSKKTGCP EDLISCADCG RSGHPSCLQF TVNMTAAVRT
310 320 330 340 350
YRWQCIECKS CSLCGTSEND GASWAGLTPQ DQLLFCDDCD RGYHMYCLSP
360 370 380
PMAEPPEGSW SCHLCLRHLK EKASAYITLT
Length:380
Mass (Da):42,502
Last modified:November 30, 2010 - v2
Checksum:iC3550A83807B4FDB
GO
Isoform 2 (identifier: Q92782-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ
     321-330: Missing.

Show »
Length:414
Mass (Da):46,785
Checksum:i343C21142565D5FF
GO
Isoform 3 (identifier: Q92782-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ
     321-330: Missing.

Show »
Length:332
Mass (Da):37,869
Checksum:iA3E86C6D5C87F240
GO

Sequence cautioni

The sequence AAC50685 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI25154 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAW56763 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25G → T in AAI25154 (PubMed:15489334).Curated1
Sequence conflicti34G → S in AAC50685 (PubMed:8812431).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07917720W → S1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0402241 – 82Missing in isoform 3. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_040225226K → ICGKRYKNRPGLSYHYTHTH LAEEEGEENAERHALPFHRK NNHKQ in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_040226321 – 330Missing in isoform 2 and isoform 3. 2 Publications10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094632 mRNA Translation: BAG52900.1
DA076421 mRNA No translation available.
AC011479 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56763.1 Sequence problems.
BC125153 mRNA Translation: AAI25154.1 Different initiation.
U43843 mRNA Translation: AAC50685.1 Different initiation.
CCDSiCCDS33008.2 [Q92782-1]
CCDS46064.1 [Q92782-2]
CCDS46065.1 [Q92782-3]
RefSeqiNP_001128627.1, NM_001135155.2 [Q92782-2]
NP_001128628.1, NM_001135156.2 [Q92782-3]
NP_001276907.1, NM_001289978.1
NP_004638.2, NM_004647.3 [Q92782-1]
UniGeneiHs.631576

Genome annotation databases

EnsembliENST00000355526; ENSP00000347716; ENSG00000011332 [Q92782-2]
ENST00000412732; ENSP00000412098; ENSG00000011332 [Q92782-3]
ENST00000414789; ENSP00000391884; ENSG00000011332 [Q92782-3]
ENST00000420980; ENSP00000397354; ENSG00000011332 [Q92782-1]
GeneIDi8193
KEGGihsa:8193
UCSCiuc002ohl.4 human [Q92782-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDPF1_HUMAN
AccessioniPrimary (citable) accession number: Q92782
Secondary accession number(s): B3KSY8, Q08AJ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 30, 2010
Last modified: March 28, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health