Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein neuro-d4

Gene

DPF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri254 – 31158PHD-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri308 – 36861PHD-type 2PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein neuro-d4
Alternative name(s):
BRG1-associated factor 45B
Short name:
BAF45B
D4, zinc and double PHD fingers family 1
Gene namesi
Name:DPF1
Synonyms:BAF45B, NEUD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:20225. DPF1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134879894.

Polymorphism and mutation databases

BioMutaiDPF1.
DMDMi313104100.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 380380Zinc finger protein neuro-d4PRO_0000168145Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki133 – 133Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ92782.
MaxQBiQ92782.
PeptideAtlasiQ92782.
PRIDEiQ92782.

PTM databases

iPTMnetiQ92782.
PhosphoSiteiQ92782.
SwissPalmiQ92782.

Expressioni

Gene expression databases

BgeeiQ92782.
CleanExiHS_DPF1.
ExpressionAtlasiQ92782. baseline and differential.
GenevisibleiQ92782. HS.

Organism-specific databases

HPAiHPA049148.

Interactioni

Subunit structurei

Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin.By similarity

Protein-protein interaction databases

BioGridi113836. 12 interactions.
IntActiQ92782. 3 interactions.
MINTiMINT-4302537.

Structurei

3D structure databases

ProteinModelPortaliQ92782.
SMRiQ92782. Positions 256-374.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the requiem/DPF family.Curated
Contains 2 PHD-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri254 – 31158PHD-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri308 – 36861PHD-type 2PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00530000063194.
HOGENOMiHOG000217918.
HOVERGENiHBG004475.
InParanoidiQ92782.
OMAiRLRPCEF.
OrthoDBiEOG7JHM5F.
PhylomeDBiQ92782.

Family and domain databases

Gene3Di3.30.40.10. 2 hits.
InterProiIPR025750. Requiem/DPF_N_dom.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 1 hit.
PF14051. Requiem_N. 1 hit.
[Graphical view]
SMARTiSM00249. PHD. 2 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q92782-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGLSARPTA GRTDPAGTCW GQDPGSKMAT VIPGPLSLGE DFYREAIEHC
60 70 80 90 100
RSYNARLCAE RSLRLPFLDS QTGVAQNNCY IWMEKTHRGP GLAPGQIYTY
110 120 130 140 150
PARCWRKKRR LNILEDPRLR PCEYKIDCEA PLKKEGGLPE GPVLEALLCA
160 170 180 190 200
ETGEKKIELK EEETIMDCQK QQLLEFPHDL EVEDLEDDIP RRKNRAKGKA
210 220 230 240 250
YGIGGLRKRQ DTASLEDRDK PYVCDKFYKE LAWVPEAQRK HTAKKAPDGT
260 270 280 290 300
VIPNGYCDFC LGGSKKTGCP EDLISCADCG RSGHPSCLQF TVNMTAAVRT
310 320 330 340 350
YRWQCIECKS CSLCGTSEND GASWAGLTPQ DQLLFCDDCD RGYHMYCLSP
360 370 380
PMAEPPEGSW SCHLCLRHLK EKASAYITLT
Length:380
Mass (Da):42,502
Last modified:November 30, 2010 - v2
Checksum:iC3550A83807B4FDB
GO
Isoform 2 (identifier: Q92782-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ
     321-330: Missing.

Show »
Length:414
Mass (Da):46,785
Checksum:i343C21142565D5FF
GO
Isoform 3 (identifier: Q92782-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     226-226: K → ICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQ
     321-330: Missing.

Show »
Length:332
Mass (Da):37,869
Checksum:iA3E86C6D5C87F240
GO

Sequence cautioni

The sequence AAC50685.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI25154.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAW56763.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251G → T in AAI25154 (PubMed:15489334).Curated
Sequence conflicti34 – 341G → S in AAC50685 (PubMed:8812431).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 3. 1 PublicationVSP_040224Add
BLAST
Alternative sequencei226 – 2261K → ICGKRYKNRPGLSYHYTHTH LAEEEGEENAERHALPFHRK NNHKQ in isoform 2 and isoform 3. 2 PublicationsVSP_040225
Alternative sequencei321 – 33010Missing in isoform 2 and isoform 3. 2 PublicationsVSP_040226

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094632 mRNA. Translation: BAG52900.1.
DA076421 mRNA. No translation available.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56763.1. Sequence problems.
BC125153 mRNA. Translation: AAI25154.1. Different initiation.
U43843 mRNA. Translation: AAC50685.1. Different initiation.
CCDSiCCDS33008.2. [Q92782-1]
CCDS46064.1. [Q92782-2]
CCDS46065.1. [Q92782-3]
RefSeqiNP_001128627.1. NM_001135155.2. [Q92782-2]
NP_001128628.1. NM_001135156.2. [Q92782-3]
NP_001276907.1. NM_001289978.1.
NP_004638.2. NM_004647.3. [Q92782-1]
UniGeneiHs.631576.

Genome annotation databases

EnsembliENST00000355526; ENSP00000347716; ENSG00000011332. [Q92782-2]
ENST00000412732; ENSP00000412098; ENSG00000011332. [Q92782-3]
ENST00000414789; ENSP00000391884; ENSG00000011332. [Q92782-3]
ENST00000420980; ENSP00000397354; ENSG00000011332. [Q92782-1]
GeneIDi8193.
KEGGihsa:8193.
UCSCiuc002ohl.4. human. [Q92782-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094632 mRNA. Translation: BAG52900.1.
DA076421 mRNA. No translation available.
AC011479 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56763.1. Sequence problems.
BC125153 mRNA. Translation: AAI25154.1. Different initiation.
U43843 mRNA. Translation: AAC50685.1. Different initiation.
CCDSiCCDS33008.2. [Q92782-1]
CCDS46064.1. [Q92782-2]
CCDS46065.1. [Q92782-3]
RefSeqiNP_001128627.1. NM_001135155.2. [Q92782-2]
NP_001128628.1. NM_001135156.2. [Q92782-3]
NP_001276907.1. NM_001289978.1.
NP_004638.2. NM_004647.3. [Q92782-1]
UniGeneiHs.631576.

3D structure databases

ProteinModelPortaliQ92782.
SMRiQ92782. Positions 256-374.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113836. 12 interactions.
IntActiQ92782. 3 interactions.
MINTiMINT-4302537.

PTM databases

iPTMnetiQ92782.
PhosphoSiteiQ92782.
SwissPalmiQ92782.

Polymorphism and mutation databases

BioMutaiDPF1.
DMDMi313104100.

Proteomic databases

EPDiQ92782.
MaxQBiQ92782.
PeptideAtlasiQ92782.
PRIDEiQ92782.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355526; ENSP00000347716; ENSG00000011332. [Q92782-2]
ENST00000412732; ENSP00000412098; ENSG00000011332. [Q92782-3]
ENST00000414789; ENSP00000391884; ENSG00000011332. [Q92782-3]
ENST00000420980; ENSP00000397354; ENSG00000011332. [Q92782-1]
GeneIDi8193.
KEGGihsa:8193.
UCSCiuc002ohl.4. human. [Q92782-1]

Organism-specific databases

CTDi8193.
GeneCardsiDPF1.
HGNCiHGNC:20225. DPF1.
HPAiHPA049148.
MIMi601670. gene.
neXtProtiNX_Q92782.
PharmGKBiPA134879894.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063194.
HOGENOMiHOG000217918.
HOVERGENiHBG004475.
InParanoidiQ92782.
OMAiRLRPCEF.
OrthoDBiEOG7JHM5F.
PhylomeDBiQ92782.

Miscellaneous databases

GenomeRNAii8193.
PROiQ92782.
SOURCEiSearch...

Gene expression databases

BgeeiQ92782.
CleanExiHS_DPF1.
ExpressionAtlasiQ92782. baseline and differential.
GenevisibleiQ92782. HS.

Family and domain databases

Gene3Di3.30.40.10. 2 hits.
InterProiIPR025750. Requiem/DPF_N_dom.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 1 hit.
PF14051. Requiem_N. 1 hit.
[Graphical view]
SMARTiSM00249. PHD. 2 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-184 (ISOFORM 1).
    Tissue: Amygdala and Cerebellum.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 25-380 (ISOFORM 2).
  5. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 26-380 (ISOFORM 1).
    Tissue: Brain.
  6. "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability."
    Xiao Z., Chang J.G., Hendriks I.A., Sigurdsson J.O., Olsen J.V., Vertegaal A.C.
    Mol. Cell. Proteomics 14:1419-1434(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-133, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDPF1_HUMAN
AccessioniPrimary (citable) accession number: Q92782
Secondary accession number(s): B3KSY8, Q08AJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 30, 2010
Last modified: July 6, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-28 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.