Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-responsive element-binding protein 1

Gene

RREB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1.6 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri66 – 8823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri97 – 11923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri125 – 14723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri208 – 23023C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri235 – 25824C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri316 – 33823C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri643 – 66523C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri671 – 69323C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri699 – 72224C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri753 – 77523C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri790 – 81526C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1246 – 126823C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1393 – 141523C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1512 – 153423C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1540 – 156223C2H2-type 15PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • multicellular organism development Source: ProtInc
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of epithelial cell migration Source: UniProtKB
  • positive regulation of lamellipodium morphogenesis Source: UniProtKB
  • positive regulation of mammary gland epithelial cell proliferation Source: UniProtKB
  • positive regulation of substrate adhesion-dependent cell spreading Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of wound healing, spreading of epidermal cells Source: UniProtKB
  • Ras protein signal transduction Source: ProtInc
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ92766.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-responsive element-binding protein 1
Short name:
RREB-1
Alternative name(s):
Finger protein in nuclear bodies
Raf-responsive zinc finger protein LZ321
Zinc finger motif enhancer-binding protein 1
Short name:
Zep-1
Gene namesi
Name:RREB1
Synonyms:FINB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:10449. RREB1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • nuclear body Source: UniProtKB
  • nuclear speck Source: UniProtKB-SubCell
  • nucleolus Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34864.

Polymorphism and mutation databases

BioMutaiRREB1.
DMDMi152031673.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16871687Ras-responsive element-binding protein 1PRO_0000047326Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei36 – 361PhosphoserineCombined sources
Modified residuei42 – 421PhosphoserineCombined sources
Modified residuei161 – 1611PhosphoserineCombined sources
Modified residuei175 – 1751PhosphoserineCombined sources
Modified residuei180 – 1801PhosphoserineCombined sources
Cross-linki203 – 203Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei231 – 2311PhosphoserineCombined sources
Cross-linki551 – 551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki615 – 615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki615 – 615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki885 – 885Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei970 – 9701PhosphoserineBy similarity
Modified residuei1122 – 11221PhosphoserineCombined sources
Modified residuei1134 – 11341PhosphoserineBy similarity
Modified residuei1135 – 11351PhosphoserineBy similarity
Modified residuei1140 – 11401PhosphoserineCombined sources
Modified residuei1167 – 11671PhosphoserineCombined sources
Modified residuei1174 – 11741PhosphoserineCombined sources
Modified residuei1175 – 11751PhosphoserineCombined sources
Modified residuei1219 – 12191PhosphoserineCombined sources
Modified residuei1225 – 12251PhosphoserineCombined sources
Modified residuei1315 – 13151PhosphothreonineCombined sources
Modified residuei1320 – 13201PhosphoserineCombined sources
Modified residuei1475 – 14751PhosphoserineCombined sources
Modified residuei1585 – 15851PhosphoserineBy similarity
Modified residuei1598 – 15981PhosphoserineBy similarity
Modified residuei1653 – 16531PhosphoserineCombined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ92766.
MaxQBiQ92766.
PeptideAtlasiQ92766.
PRIDEiQ92766.

PTM databases

iPTMnetiQ92766.
PhosphoSiteiQ92766.

Expressioni

Tissue specificityi

Expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not found in the brain.1 Publication

Gene expression databases

BgeeiENSG00000124782.
ExpressionAtlasiQ92766. baseline and differential.
GenevisibleiQ92766. HS.

Organism-specific databases

HPAiHPA001756.
HPA034843.

Interactioni

Subunit structurei

Interacts with NEUROD1 and AR.2 Publications

Protein-protein interaction databases

BioGridi112153. 13 interactions.
IntActiQ92766. 15 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ92766.
SMRiQ92766. Positions 66-231, 310-351, 643-808, 1387-1564.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi481 – 54666Pro-richAdd
BLAST
Compositional biasi877 – 8804Poly-Pro
Compositional biasi969 – 106496Pro-richAdd
BLAST

Sequence similaritiesi

Contains 15 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri66 – 8823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri97 – 11923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri125 – 14723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri208 – 23023C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri235 – 25824C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri316 – 33823C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri643 – 66523C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri671 – 69323C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri699 – 72224C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri753 – 77523C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri790 – 81526C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1246 – 126823C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1393 – 141523C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1512 – 153423C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1540 – 156223C2H2-type 15PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00530000063079.
HOVERGENiHBG108418.
InParanoidiQ92766.
KOiK20210.
OMAiYRALRIH.
OrthoDBiEOG091G0AFV.
PhylomeDBiQ92766.
TreeFamiTF332503.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92766-1) [UniParc]FASTAAdd to basket
Also known as: beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSSPAGLE GSDLSSINTM MSAVMSVGKV TENGGSPQGI KSPSKPPGPN
60 70 80 90 100
RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHSCS
110 120 130 140 150
ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD
160 170 180 190 200
PNSATATAPP SPLKRRRLSS KRKLSHDAES EREDPAPAKK MVEDGQSGDL
210 220 230 240 250
EKKADEVFHC PVCFKEFVCK YGLETHMETH SDNPLRCDIC CVTFRTHRGL
260 270 280 290 300
LRHNALVHKQ LPRDAMGRPF IQNNPSIPAG FHDLGFTDFS CRKFPRISQA
310 320 330 340 350
WCETNLRRCI SEQHRFVCDT CDKAFPMLCS LALHKQTHVA ADQGQEKPQA
360 370 380 390 400
TPLPGDALDQ KGFLALLGLQ HTKDVRPAPA EEPLPDDNQA IQLQTLKCQL
410 420 430 440 450
PQDPGCTNLL SLSPFEAASL GGSLTVLPAT KDSIKHLSLQ PFQKGFIIQP
460 470 480 490 500
DSSIVVKPIS GESAIELADI QQILKMAASA PPQISLPPFS KAPAAPLQAI
510 520 530 540 550
FKHMPPLKPK PLVTPRTVVA TSTPPPLINA QQASPGCISP SLPPPPLKLL
560 570 580 590 600
KGSVEAASNA HLLQSKSGTQ PHAATRLSLQ QPRAELPGQP EMKTQLEQDS
610 620 630 640 650
IIEALLPLSM EAKIKQEITE GELKAFMTAP GGKKTPAMRK VLYPCRFCNQ
660 670 680 690 700
VFAFSGVLRA HVRSHLGISP YQCNICDYIA ADKAALIRHL RTHSGERPYI
710 720 730 740 750
CKICHYPFTV KANCERHLRK KHLKATRKDI EKNIEYVSSS AAELVDAFCA
760 770 780 790 800
PDTVCRLCGE DLKHYRALRI HMRTHCGRGL GGGHKGRKPF ECKECSAAFA
810 820 830 840 850
AKRNCIHHIL KQHLHVPEQD IESYVLAADG LGPAEAPAAE ASGRGEDSGC
860 870 880 890 900
AALGDCKPLT AFLEPQNGFL HRGPTQPPPP HVSIKLEPAS SFAVDFNEPL
910 920 930 940 950
DFSQKGLALV QVKQENISFL SPSSLVPYDC SMEPIDLSIP KNFRKGDKDL
960 970 980 990 1000
ATPSEAKKPE EEAGSSEQPS PCPAPGPSLP VTLGPSGILE SPMAPAPAAT
1010 1020 1030 1040 1050
PEPPAQPLQG PVQLAVPIYS SALVSSPPLV GSSALLSGTA LLRPLRPKPP
1060 1070 1080 1090 1100
LLLPKPPVTE ELPPLASIAQ IISSVSSAPT LLKTKVADPG PASTGSNTTA
1110 1120 1130 1140 1150
SDSLGGSVPK AATTATPAAT TSPKESSEPP APASSPEAAS PTEQGPAGTS
1160 1170 1180 1190 1200
KKRGRKRGMR SRPRANSGGV DLDSSGEFAS IEKMLATTDT NKFSPFLQTA
1210 1220 1230 1240 1250
EDNTQDEVAG APADHHGPSD EEQGSPPEDK LLRAKRNSYT NCLQKITCPH
1260 1270 1280 1290 1300
CPRVFPWASS LQRHMLTHTD SQSDAETAAA AGEVLDLTSR DREQPSEGAT
1310 1320 1330 1340 1350
ELRQVAGDAP VEQATAETAS PVHREEHGRG ESHEPEEEHG TEESTGDADG
1360 1370 1380 1390 1400
AEEDASSNQS LDLDFATKLM DFKLAEGDGE AGAGGAASQE QKLACDTCGK
1410 1420 1430 1440 1450
SFKFLGTLSR HRKAHGRQEP KDEKGDGAST AEEGPQPAPE QEEKPPETPA
1460 1470 1480 1490 1500
EVVESAPGAG EAPAEKLAEE TEGPSDGESA AEKRSSEKSD DDKKPKTDSP
1510 1520 1530 1540 1550
KSVASKADKR KKVCSVCNKR FWSLQDLTRH MRSHTGERPY KCQTCERTFT
1560 1570 1580 1590 1600
LKHSLVRHQR IHQKARHAKH HGKDSDKEER GEEDSENEST HSGNNAVSEN
1610 1620 1630 1640 1650
EAELAPNASN HMAVTRSRKE GLASATKDCS HREEKVTAGW PSEPGQGDLN
1660 1670 1680
PESPAALGQD LLEPRSKRPA HPILATADGA SQLVGME
Length:1,687
Mass (Da):181,420
Last modified:July 10, 2007 - v3
Checksum:i33B5755B0243C64F
GO
Isoform 2 (identifier: Q92766-2) [UniParc]FASTAAdd to basket
Also known as: alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1269: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPQSKESDVGSHDST

Show »
Length:1,742
Mass (Da):187,551
Checksum:i1344C2619E7A7241
GO
Isoform 3 (identifier: Q92766-3) [UniParc]FASTAAdd to basket
Also known as: gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1534: DSQSDAETAA...QDLTRHMRSH → GQKPFPCQKC...KESDVGSHDS

Show »
Length:1,476
Mass (Da):159,331
Checksum:iDB242C01B42D9592
GO
Isoform 4 (identifier: Q92766-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1200: Missing.
     1201-1268: EDNTQDEVAG...SSLQRHMLTH → MLTHTGQKPF...KESDVGSHDS

Show »
Length:478
Mass (Da):51,610
Checksum:i92323DDA34814C60
GO
Isoform 5 (identifier: Q92766-5) [UniParc]FASTAAdd to basket
Also known as: delta

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1535: Missing.

Show »
Length:1,421
Mass (Da):153,200
Checksum:i31241D101F0B5C48
GO
Isoform 6 (identifier: Q92766-6) [UniParc]FASTAAdd to basket
Also known as: epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     300-314: AWCETNLRRCISEQH → GKGHTNVRPASEPSP
     315-1687: Missing.

Show »
Length:314
Mass (Da):34,614
Checksum:iDAD3CC4A2A045F89
GO

Sequence cautioni

The sequence AAB19094 differs from that shown. Reason: Frameshift at positions 908, 1350 and 1383. Curated
The sequence AAC25598 differs from that shown. Reason: Frameshift at positions 1350 and 1383. Curated
The sequence AAC26118 differs from that shown. Reason: Frameshift at positions 1350 and 1383. Curated
Isoform 2 : The sequence AAC26118 differs from that shown. Reason: Frameshift at position 1271. Curated
The sequence AAH42910 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH42910 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA23165 differs from that shown.Numerous sequencing errors.Curated
The sequence CAH73521 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti574 – 5741A → T in ADO14469 (PubMed:21703425).Curated
Sequence conflicti866 – 8661Q → K in AAB19094 (PubMed:8816445).Curated
Sequence conflicti994 – 9941A → V in ADO14469 (PubMed:21703425).Curated
Sequence conflicti1148 – 11481G → R in AAB19094 (PubMed:8816445).Curated
Sequence conflicti1321 – 13211P → R in AAC25598 (PubMed:10390538).Curated
Sequence conflicti1321 – 13211P → R in AAC26118 (PubMed:10390538).Curated
Sequence conflicti1394 – 13952AC → SS in AAC25598 (PubMed:10390538).Curated
Sequence conflicti1394 – 13952AC → SS in AAC26118 (PubMed:10390538).Curated
Sequence conflicti1429 – 14291S → T in AAB19094 (PubMed:8816445).Curated
Sequence conflicti1436 – 14361Q → S in AAB19094 (PubMed:8816445).Curated
Sequence conflicti1683 – 16831L → H in AAB19094 (PubMed:8816445).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti195 – 1951G → R.3 Publications
Corresponds to variant rs1334576 [ dbSNP | Ensembl ].
VAR_033197
Natural varianti783 – 7831G → V.2 Publications
Corresponds to variant rs9502564 [ dbSNP | Ensembl ].
VAR_033198
Natural varianti1171 – 11711D → N.
Corresponds to variant rs9379084 [ dbSNP | Ensembl ].
VAR_033199
Natural varianti1384 – 13841G → R.
Corresponds to variant rs2281833 [ dbSNP | Ensembl ].
VAR_033200
Natural varianti1467 – 14671L → P.3 Publications
Corresponds to variant rs2256596 [ dbSNP | Ensembl ].
VAR_033201
Natural varianti1499 – 14991S → Y.
Corresponds to variant rs35742417 [ dbSNP | Ensembl ].
VAR_033202

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 12001200Missing in isoform 4. 1 PublicationVSP_026704Add
BLAST
Alternative sequencei300 – 31415AWCET…ISEQH → GKGHTNVRPASEPSP in isoform 6. 1 PublicationVSP_053538Add
BLAST
Alternative sequencei315 – 16871373Missing in isoform 6. 1 PublicationVSP_053539Add
BLAST
Alternative sequencei1201 – 126868EDNTQ…HMLTH → MLTHTGQKPFPCQKCDAFFS TKSNCERHQLRKHGVTTCSL RRNGLIPQSKESDVGSHDS in isoform 4. 1 PublicationVSP_026705Add
BLAST
Alternative sequencei1269 – 12691T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPQSKESDVGSHDST in isoform 2. 2 PublicationsVSP_026706
Alternative sequencei1270 – 1535266Missing in isoform 5. 1 PublicationVSP_053540Add
BLAST
Alternative sequencei1270 – 1534265DSQSD…HMRSH → GQKPFPCQKCDAFFSTKSNC ERHQLRKHGVTTCSLRRNGL IPQSKESDVGSHDS in isoform 3. 1 PublicationVSP_026707Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49835 mRNA. Translation: BAA23165.1. Sequence problems.
AB019254 mRNA. Translation: BAD32776.1.
AB019351 mRNA. Translation: BAD32778.1.
AB019352 mRNA. Translation: BAD32779.1.
HM369360 mRNA. Translation: ADO14468.1.
HM369361 mRNA. Translation: ADO14469.1.
AL355336, AL139095, AL589644 Genomic DNA. Translation: CAH73521.1. Different initiation.
AL589644, AL139095, AL355336 Genomic DNA. Translation: CAI14574.1.
AL139095, AL355336, AL589644 Genomic DNA. Translation: CAI16450.1.
BC042910 mRNA. Translation: AAH42910.1. Sequence problems.
BC131599 mRNA. Translation: AAI31600.1.
U26914 mRNA. Translation: AAB19094.1. Frameshift.
AF072825 mRNA. Translation: AAC25598.1. Frameshift.
AF072826 mRNA. Translation: AAC26118.1. Frameshift.
CCDSiCCDS34335.1. [Q92766-2]
CCDS34336.1. [Q92766-1]
CCDS54963.1. [Q92766-3]
RefSeqiNP_001003698.1. NM_001003698.3. [Q92766-1]
NP_001003699.1. NM_001003699.3. [Q92766-2]
NP_001003700.1. NM_001003700.1. [Q92766-3]
NP_001161816.1. NM_001168344.1. [Q92766-1]
XP_006715220.1. XM_006715157.3. [Q92766-2]
XP_011513097.1. XM_011514795.2. [Q92766-5]
UniGeneiHs.298248.

Genome annotation databases

EnsembliENST00000334984; ENSP00000335574; ENSG00000124782. [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782. [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782. [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782. [Q92766-2]
GeneIDi6239.
KEGGihsa:6239.
UCSCiuc003mxb.4. human. [Q92766-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49835 mRNA. Translation: BAA23165.1. Sequence problems.
AB019254 mRNA. Translation: BAD32776.1.
AB019351 mRNA. Translation: BAD32778.1.
AB019352 mRNA. Translation: BAD32779.1.
HM369360 mRNA. Translation: ADO14468.1.
HM369361 mRNA. Translation: ADO14469.1.
AL355336, AL139095, AL589644 Genomic DNA. Translation: CAH73521.1. Different initiation.
AL589644, AL139095, AL355336 Genomic DNA. Translation: CAI14574.1.
AL139095, AL355336, AL589644 Genomic DNA. Translation: CAI16450.1.
BC042910 mRNA. Translation: AAH42910.1. Sequence problems.
BC131599 mRNA. Translation: AAI31600.1.
U26914 mRNA. Translation: AAB19094.1. Frameshift.
AF072825 mRNA. Translation: AAC25598.1. Frameshift.
AF072826 mRNA. Translation: AAC26118.1. Frameshift.
CCDSiCCDS34335.1. [Q92766-2]
CCDS34336.1. [Q92766-1]
CCDS54963.1. [Q92766-3]
RefSeqiNP_001003698.1. NM_001003698.3. [Q92766-1]
NP_001003699.1. NM_001003699.3. [Q92766-2]
NP_001003700.1. NM_001003700.1. [Q92766-3]
NP_001161816.1. NM_001168344.1. [Q92766-1]
XP_006715220.1. XM_006715157.3. [Q92766-2]
XP_011513097.1. XM_011514795.2. [Q92766-5]
UniGeneiHs.298248.

3D structure databases

ProteinModelPortaliQ92766.
SMRiQ92766. Positions 66-231, 310-351, 643-808, 1387-1564.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112153. 13 interactions.
IntActiQ92766. 15 interactions.

PTM databases

iPTMnetiQ92766.
PhosphoSiteiQ92766.

Polymorphism and mutation databases

BioMutaiRREB1.
DMDMi152031673.

Proteomic databases

EPDiQ92766.
MaxQBiQ92766.
PeptideAtlasiQ92766.
PRIDEiQ92766.

Protocols and materials databases

DNASUi6239.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334984; ENSP00000335574; ENSG00000124782. [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782. [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782. [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782. [Q92766-2]
GeneIDi6239.
KEGGihsa:6239.
UCSCiuc003mxb.4. human. [Q92766-1]

Organism-specific databases

CTDi6239.
GeneCardsiRREB1.
HGNCiHGNC:10449. RREB1.
HPAiHPA001756.
HPA034843.
MIMi602209. gene.
neXtProtiNX_Q92766.
PharmGKBiPA34864.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063079.
HOVERGENiHBG108418.
InParanoidiQ92766.
KOiK20210.
OMAiYRALRIH.
OrthoDBiEOG091G0AFV.
PhylomeDBiQ92766.
TreeFamiTF332503.

Enzyme and pathway databases

SignaLinkiQ92766.

Miscellaneous databases

ChiTaRSiRREB1. human.
GeneWikiiRREB1.
GenomeRNAii6239.
PROiQ92766.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124782.
ExpressionAtlasiQ92766. baseline and differential.
GenevisibleiQ92766. HS.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRREB1_HUMAN
AccessioniPrimary (citable) accession number: Q92766
Secondary accession number(s): A2RRF5
, E2GM80, E2GM81, O75567, O75568, Q5VYB2, Q6BEP5, Q6BEP6, Q6BEP8, Q86SU2, Q9Y474
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 10, 2007
Last modified: September 7, 2016
This is version 148 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.