Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-related protein 2/3 complex subunit 1A

Gene

ARPC1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-3928662. EPHB-mediated forward signaling.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.
R-HSA-8856828. Clathrin-mediated endocytosis.
SignaLinkiQ92747.
SIGNORiQ92747.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-related protein 2/3 complex subunit 1A
Alternative name(s):
SOP2-like protein
Gene namesi
Name:ARPC1A
Synonyms:SOP2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:703. ARPC1A.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: ProtInc
  • Arp2/3 protein complex Source: GO_Central
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi10552.
OpenTargetsiENSG00000241685.
PharmGKBiPA24997.

Polymorphism and mutation databases

BioMutaiARPC1A.
DMDMi88984001.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000508521 – 370Actin-related protein 2/3 complex subunit 1AAdd BLAST370

Proteomic databases

EPDiQ92747.
PaxDbiQ92747.
PeptideAtlasiQ92747.
PRIDEiQ92747.

PTM databases

iPTMnetiQ92747.
PhosphoSitePlusiQ92747.
SwissPalmiQ92747.

Expressioni

Gene expression databases

BgeeiENSG00000241685.
CleanExiHS_ARPC1A.
ExpressionAtlasiQ92747. baseline and differential.
GenevisibleiQ92747. HS.

Organism-specific databases

HPAiHPA004334.

Interactioni

Subunit structurei

Probable component of the Arp2/3 complex in which it may replace ARPC1B.

GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: GO_Central

Protein-protein interaction databases

BioGridi115803. 34 interactors.
DIPiDIP-33142N.
IntActiQ92747. 7 interactors.
MINTiMINT-3049287.
STRINGi9606.ENSP00000262942.

Structurei

3D structure databases

ProteinModelPortaliQ92747.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati6 – 45WD 1Add BLAST40
Repeati50 – 89WD 2Add BLAST40
Repeati140 – 179WD 3Add BLAST40
Repeati202 – 241WD 4Add BLAST40
Repeati244 – 284WD 5Add BLAST41
Repeati322 – 365WD 6Add BLAST44

Sequence similaritiesi

Belongs to the WD repeat ARPC1 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1523. Eukaryota.
ENOG410XNWX. LUCA.
GeneTreeiENSGT00390000008339.
HOGENOMiHOG000181752.
HOVERGENiHBG050560.
InParanoidiQ92747.
KOiK05757.
OMAiTVCGEYL.
OrthoDBiEOG091G096H.
PhylomeDBiQ92747.
TreeFamiTF315041.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiView protein in InterPro
IPR030140. ARC1A.
IPR017383. ARPC1.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
PANTHERiPTHR10709. PTHR10709. 1 hit.
PTHR10709:SF21. PTHR10709:SF21. 1 hit.
PfamiView protein in Pfam
PF00400. WD40. 2 hits.
PIRSFiPIRSF038093. ARP2/3_su1. 1 hit.
SMARTiView protein in SMART
SM00320. WD40. 6 hits.
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiView protein in PROSITE
PS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92747-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLHQFLLEP ITCHAWNRDR TQIALSPNNH EVHIYKKNGS QWVKAHELKE
60 70 80 90 100
HNGHITGIDW APKSDRIVTC GADRNAYVWS QKDGVWKPTL VILRINRAAT
110 120 130 140 150
FVKWSPLENK FAVGSGARLI SVCYFESEND WWVSKHIKKP IRSTVLSLDW
160 170 180 190 200
HPNNVLLAAG SCDFKCRVFS AYIKEVDEKP ASTPWGSKMP FGQLMSEFGG
210 220 230 240 250
SGTGGWVHGV SFSASGSRLA WVSHDSTVSV ADASKSVQVS TLKTEFLPLL
260 270 280 290 300
SVSFVSENSV VAAGHDCCPM LFNYDDRGCL TFVSKLDIPK QSIQRNMSAM
310 320 330 340 350
ERFRNMDKRA TTEDRNTALE TLHQNSITQV SIYEVDKQDC RKFCTTGIDG
360 370
AMTIWDFKTL ESSIQGLRIM
Length:370
Mass (Da):41,569
Last modified:February 21, 2006 - v2
Checksum:i57FA5AC69997636E
GO
Isoform 2 (identifier: Q92747-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITG → MHERFIHCFC
     359-370: TLESSIQGLRIM → EPSRHGLPQLPGGAHQLPRLEQGPHPDCHLPQQP

Note: No experimental confirmation available.
Show »
Length:345
Mass (Da):38,603
Checksum:i84495A5242F16A89
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti127S → A in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti180P → K in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti273N → I in CAA70203 (PubMed:8978670).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0563891 – 57MSLHQ…GHITG → MHERFIHCFC in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_056390359 – 370TLESS…GLRIM → EPSRHGLPQLPGGAHQLPRL EQGPHPDCHLPQQP in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08999 mRNA. Translation: CAA70203.1.
AK297111 mRNA. Translation: BAG59619.1.
AC004834 Genomic DNA. No translation available.
AC004922 Genomic DNA. No translation available.
CH236956 Genomic DNA. Translation: EAL23883.1.
CH471091 Genomic DNA. Translation: EAW76682.1.
CH471091 Genomic DNA. Translation: EAW76683.1.
BC039594 mRNA. Translation: AAH39594.2.
BC047889 mRNA. Translation: AAH47889.2.
BC054027 mRNA. Translation: AAH54027.1.
CCDSiCCDS5660.1. [Q92747-1]
RefSeqiNP_006400.2. NM_006409.3. [Q92747-1]
UniGeneiHs.124126.

Genome annotation databases

EnsembliENST00000262942; ENSP00000262942; ENSG00000241685. [Q92747-1]
GeneIDi10552.
KEGGihsa:10552.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiARC1A_HUMAN
AccessioniPrimary (citable) accession number: Q92747
Secondary accession number(s): A4D276
, B4DLQ7, D6W5S1, Q7Z5U8, Q86WU5, Q8IXQ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: February 21, 2006
Last modified: August 30, 2017
This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families