Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-related protein 2/3 complex subunit 1A

Gene

ARPC1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-3928662 EPHB-mediated forward signaling
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
R-HSA-8856828 Clathrin-mediated endocytosis
SignaLinkiQ92747
SIGNORiQ92747

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-related protein 2/3 complex subunit 1A
Alternative name(s):
SOP2-like protein
Gene namesi
Name:ARPC1A
Synonyms:SOP2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000241685.8
HGNCiHGNC:703 ARPC1A
MIMi604220 gene
neXtProtiNX_Q92747

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi10552
OpenTargetsiENSG00000241685
PharmGKBiPA24997

Polymorphism and mutation databases

BioMutaiARPC1A
DMDMi88984001

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000508521 – 370Actin-related protein 2/3 complex subunit 1AAdd BLAST370

Proteomic databases

EPDiQ92747
PaxDbiQ92747
PeptideAtlasiQ92747
PRIDEiQ92747
ProteomicsDBi75438

PTM databases

iPTMnetiQ92747
PhosphoSitePlusiQ92747
SwissPalmiQ92747

Expressioni

Gene expression databases

BgeeiENSG00000241685
CleanExiHS_ARPC1A
ExpressionAtlasiQ92747 baseline and differential
GenevisibleiQ92747 HS

Organism-specific databases

HPAiHPA004334

Interactioni

Subunit structurei

Probable component of the Arp2/3 complex in which it may replace ARPC1B.

GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: GO_Central

Protein-protein interaction databases

BioGridi115803, 35 interactors
DIPiDIP-33142N
IntActiQ92747, 14 interactors
STRINGi9606.ENSP00000262942

Structurei

3D structure databases

ProteinModelPortaliQ92747
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati6 – 45WD 1Add BLAST40
Repeati50 – 89WD 2Add BLAST40
Repeati140 – 179WD 3Add BLAST40
Repeati202 – 241WD 4Add BLAST40
Repeati244 – 284WD 5Add BLAST41
Repeati322 – 365WD 6Add BLAST44

Sequence similaritiesi

Belongs to the WD repeat ARPC1 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1523 Eukaryota
ENOG410XNWX LUCA
GeneTreeiENSGT00390000008339
HOGENOMiHOG000181752
HOVERGENiHBG050560
InParanoidiQ92747
KOiK05757
OMAiTVCGEYL
OrthoDBiEOG091G096H
PhylomeDBiQ92747
TreeFamiTF315041

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR030140 ARC1A
IPR017383 ARPC1
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10709 PTHR10709, 1 hit
PTHR10709:SF11 PTHR10709:SF11, 1 hit
PfamiView protein in Pfam
PF00400 WD40, 2 hits
PIRSFiPIRSF038093 ARP2/3_su1, 1 hit
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92747-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLHQFLLEP ITCHAWNRDR TQIALSPNNH EVHIYKKNGS QWVKAHELKE
60 70 80 90 100
HNGHITGIDW APKSDRIVTC GADRNAYVWS QKDGVWKPTL VILRINRAAT
110 120 130 140 150
FVKWSPLENK FAVGSGARLI SVCYFESEND WWVSKHIKKP IRSTVLSLDW
160 170 180 190 200
HPNNVLLAAG SCDFKCRVFS AYIKEVDEKP ASTPWGSKMP FGQLMSEFGG
210 220 230 240 250
SGTGGWVHGV SFSASGSRLA WVSHDSTVSV ADASKSVQVS TLKTEFLPLL
260 270 280 290 300
SVSFVSENSV VAAGHDCCPM LFNYDDRGCL TFVSKLDIPK QSIQRNMSAM
310 320 330 340 350
ERFRNMDKRA TTEDRNTALE TLHQNSITQV SIYEVDKQDC RKFCTTGIDG
360 370
AMTIWDFKTL ESSIQGLRIM
Length:370
Mass (Da):41,569
Last modified:February 21, 2006 - v2
Checksum:i57FA5AC69997636E
GO
Isoform 2 (identifier: Q92747-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITG → MHERFIHCFC
     359-370: TLESSIQGLRIM → EPSRHGLPQLPGGAHQLPRLEQGPHPDCHLPQQP

Note: No experimental confirmation available.
Show »
Length:345
Mass (Da):38,603
Checksum:i84495A5242F16A89
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti127S → A in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti180P → K in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti273N → I in CAA70203 (PubMed:8978670).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0563891 – 57MSLHQ…GHITG → MHERFIHCFC in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_056390359 – 370TLESS…GLRIM → EPSRHGLPQLPGGAHQLPRL EQGPHPDCHLPQQP in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08999 mRNA Translation: CAA70203.1
AK297111 mRNA Translation: BAG59619.1
AC004834 Genomic DNA No translation available.
AC004922 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23883.1
CH471091 Genomic DNA Translation: EAW76682.1
CH471091 Genomic DNA Translation: EAW76683.1
BC039594 mRNA Translation: AAH39594.2
BC047889 mRNA Translation: AAH47889.2
BC054027 mRNA Translation: AAH54027.1
CCDSiCCDS5660.1 [Q92747-1]
RefSeqiNP_006400.2, NM_006409.3 [Q92747-1]
UniGeneiHs.124126

Genome annotation databases

EnsembliENST00000262942; ENSP00000262942; ENSG00000241685 [Q92747-1]
GeneIDi10552
KEGGihsa:10552

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiARC1A_HUMAN
AccessioniPrimary (citable) accession number: Q92747
Secondary accession number(s): A4D276
, B4DLQ7, D6W5S1, Q7Z5U8, Q86WU5, Q8IXQ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: February 21, 2006
Last modified: June 20, 2018
This is version 159 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health