Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Estrogen receptor beta

Gene

ESR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi149 – 214Nuclear receptorPROSITE-ProRule annotationAdd BLAST66
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

  • core promoter sequence-specific DNA binding Source: UniProtKB
  • DNA binding Source: ProtInc
  • enzyme binding Source: UniProtKB
  • estrogen receptor activity Source: UniProtKB
  • estrogen response element binding Source: UniProtKB
  • receptor antagonist activity Source: UniProtKB
  • RNA polymerase II transcription factor activity, estrogen-activated sequence-specific DNA binding Source: ParkinsonsUK-UCL
  • RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding Source: UniProtKB
  • steroid binding Source: UniProtKB
  • steroid hormone receptor activity Source: ProtInc
  • transcription coactivator activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc
  • zinc ion binding Source: InterPro

GO - Biological processi

  • cell-cell signaling Source: ProtInc
  • intracellular estrogen receptor signaling pathway Source: UniProtKB
  • negative regulation of cell growth Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of sequence-specific DNA binding transcription factor activity Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB
  • signal transduction Source: ProtInc
  • transcription initiation from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Activator, Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Lipid-binding, Metal-binding, Steroid-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140009-MONOMER.
ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiQ92731.
SIGNORiQ92731.

Names & Taxonomyi

Protein namesi
Recommended name:
Estrogen receptor beta
Short name:
ER-beta
Alternative name(s):
Nuclear receptor subfamily 3 group A member 2
Gene namesi
Name:ESR2
Synonyms:ESTRB, NR3A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:3468. ESR2.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: GOC
  • mitochondrion Source: MGI
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi87S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-105. 1 Publication1
Mutagenesisi87S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-105. 1 Publication1
Mutagenesisi105S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-87. 1 Publication1
Mutagenesisi105S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-87. 1 Publication1

Organism-specific databases

DisGeNETi2100.
OpenTargetsiENSG00000140009.
PharmGKBiPA27886.

Chemistry databases

ChEMBLiCHEMBL242.
DrugBankiDB00255. Diethylstilbestrol.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB04574. Estropipate.
DB00481. Raloxifene.
DB00675. Tamoxifen.
DB01108. Trilostane.
GuidetoPHARMACOLOGYi621.

Polymorphism and mutation databases

BioMutaiESR2.
DMDMi6166154.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000536421 – 530Estrogen receptor betaAdd BLAST530

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei87Phosphoserine1 Publication1
Modified residuei105Phosphoserine1 Publication1

Post-translational modificationi

Phosphorylation at Ser-87 and Ser-105 recruits NCOA1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ92731.
PeptideAtlasiQ92731.
PRIDEiQ92731.

PTM databases

iPTMnetiQ92731.
PhosphoSitePlusiQ92731.
SwissPalmiQ92731.

Miscellaneous databases

PMAP-CutDBA8K8K5.

Expressioni

Tissue specificityi

Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors. Isoform 2 is expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus. Isoform 4 is found in testis. Isoform 5 is expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus. Isoform 6 is expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain.

Gene expression databases

BgeeiENSG00000140009.
ExpressionAtlasiQ92731. baseline and differential.
GenevisibleiQ92731. HS.

Organism-specific databases

HPAiCAB022544.

Interactioni

Subunit structurei

Binds DNA as a homodimer. Can form a heterodimer with ESR1. Interacts with NCOA1, NCOA3, NCOA5 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Interacts with PELP1 and UBE1C. Isoform 2 preferentially forms a heterodimer with ESR1 rather than ESR2 and inhibits DNA-binding by ESR1. Interacts with AKAP13. Interacts with DNTTIP2. Interacts with isoform 4 of TXNRD1. Interacts with CCDC62 in the presence of estradiol/E2; this interaction seems to enhance the transcription of target genes, including cyclin-D1/CCND1 AP-1 promoter. Interacts with DYX1C1 (By similarity). Interacts with PRMT2. Interacts with CCAR2 (via N-terminus) in a ligand-independent manner.By similarity10 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PLSCR1O151623EBI-78505,EBI-740019
PPP5CP530414EBI-78505,EBI-716663
TXNRD1Q16881-43EBI-78505,EBI-9080335

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • receptor antagonist activity Source: UniProtKB

Protein-protein interaction databases

BioGridi108404. 100 interactors.
DIPiDIP-5966N.
IntActiQ92731. 424 interactors.
STRINGi9606.ENSP00000343925.

Chemistry databases

BindingDBiQ92731.

Structurei

Secondary structure

1530
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi257 – 260Combined sources4
Helixi261 – 263Combined sources3
Helixi265 – 275Combined sources11
Beta strandi286 – 288Combined sources3
Helixi291 – 314Combined sources24
Helixi319 – 321Combined sources3
Helixi324 – 347Combined sources24
Beta strandi348 – 350Combined sources3
Beta strandi353 – 357Combined sources5
Beta strandi359 – 363Combined sources5
Helixi364 – 369Combined sources6
Helixi373 – 389Combined sources17
Helixi394 – 406Combined sources13
Beta strandi407 – 409Combined sources3
Helixi411 – 413Combined sources3
Helixi417 – 419Combined sources3
Helixi421 – 442Combined sources22
Turni443 – 445Combined sources3
Helixi448 – 481Combined sources34
Beta strandi482 – 484Combined sources3
Helixi489 – 497Combined sources9
Helixi498 – 501Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
DisProtiDP00079.
ProteinModelPortaliQ92731.
SMRiQ92731.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92731.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 148ModulatingAdd BLAST148
Regioni215 – 530Steroid-bindingAdd BLAST316

Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00760000118887.
HOVERGENiHBG108344.
InParanoidiQ92731.
KOiK08551.
OMAiEPQKSPW.
OrthoDBiEOG091G03V4.
PhylomeDBiQ92731.
TreeFamiTF323751.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR028355. ER-beta/gamma.
IPR021064. Estrogen_rcpt_beta_N.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR024178. Oest_rcpt/oest-rel_rcp.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF12497. ERbeta_N. 1 hit.
PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PIRSFiPIRSF500102. ER-b. 1 hit.
PIRSF002527. ER-like_NR. 1 hit.
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92731-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDIKNSPSSL NSPSSYNCSQ SILPLEHGSI YIPSSYVDSH HEYPAMTFYS
60 70 80 90 100
PAVMNYSIPS NVTNLEGGPG RQTTSPNVLW PTPGHLSPLV VHRQLSHLYA
110 120 130 140 150
EPQKSPWCEA RSLEHTLPVN RETLKRKVSG NRCASPVTGP GSKRDAHFCA
160 170 180 190 200
VCSDYASGYH YGVWSCEGCK AFFKRSIQGH NDYICPATNQ CTIDKNRRKS
210 220 230 240 250
CQACRLRKCY EVGMVKCGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGG
260 270 280 290 300
HAPRVRELLL DALSPEQLVL TLLEAEPPHV LISRPSAPFT EASMMMSLTK
310 320 330 340 350
LADKELVHMI SWAKKIPGFV ELSLFDQVRL LESCWMEVLM MGLMWRSIDH
360 370 380 390 400
PGKLIFAPDL VLDRDEGKCV EGILEIFDML LATTSRFREL KLQHKEYLCV
410 420 430 440 450
KAMILLNSSM YPLVTATQDA DSSRKLAHLL NAVTDALVWV IAKSGISSQQ
460 470 480 490 500
QSMRLANLLM LLSHVRHASN KGMEHLLNMK CKNVVPVYDL LLEMLNAHVL
510 520 530
RGCKSSITGS ECSPAEDSKS KEGSQNPQSQ
Length:530
Mass (Da):59,216
Last modified:July 15, 1999 - v2
Checksum:i8CAE34215992418A
GO
Isoform 2 (identifier: Q92731-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2, CX

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → RAEKASQTLTSFGMKMETLLPEATMEQ

Show »
Length:495
Mass (Da):55,483
Checksum:iF068DBC63DC838A6
GO
Isoform 3 (identifier: Q92731-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2A

The sequence of this isoform differs from the canonical sequence as follows:
     319-323: FVELS → MRGNA
     324-530: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:323
Mass (Da):35,944
Checksum:i158D376C56D3CA12
GO
Isoform 4 (identifier: Q92731-4) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → SSLSLSWRLF...SFEACQQPRE

Show »
Length:513
Mass (Da):57,518
Checksum:iEE88C42CBB24775E
GO
Isoform 5 (identifier: Q92731-5) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RWGEKQFIHLKLS

Note: Does not form homodimers.
Show »
Length:481
Mass (Da):54,096
Checksum:i9B6017FE950720F0
GO
Isoform 6 (identifier: Q92731-6) [UniParc]FASTAAdd to basket
Also known as: Beta-5

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RYAP

Note: Does not form homodimers.
Show »
Length:472
Mass (Da):52,959
Checksum:i673B0DB5FAF03C26
GO
Isoform 7 (identifier: Q92731-7) [UniParc]FASTAAdd to basket
Also known as: Beta-5A

The sequence of this isoform differs from the canonical sequence as follows:
     319-409: Missing.

Show »
Length:439
Mass (Da):48,614
Checksum:i35B686E3C0D32D0F
GO
Isoform 8 (identifier: Q92731-8) [UniParc]FASTAAdd to basket
Also known as: Beta-6

The sequence of this isoform differs from the canonical sequence as follows:
     365-375: DEGKCVEGILE → YVPSGHSDPGC
     376-530: Missing.

Show »
Length:375
Mass (Da):41,948
Checksum:iE2FA83EE3C519EE5
GO
Isoform 9 (identifier: Q92731-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-474: SNKGME → RSCVYK
     475-530: Missing.

Show »
Length:474
Mass (Da):53,209
Checksum:i4558F2986355FAF0
GO

Sequence cautioni

The sequence CAA67555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003685319 – 409Missing in isoform 7. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_003684319 – 323FVELS → MRGNA in isoform 3. 2 Publications5
Alternative sequenceiVSP_003686324 – 530Missing in isoform 3. 2 PublicationsAdd BLAST207
Alternative sequenceiVSP_003687365 – 375DEGKCVEGILE → YVPSGHSDPGC in isoform 8. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_003688376 – 530Missing in isoform 8. 1 PublicationAdd BLAST155
Alternative sequenceiVSP_003689469 – 530SNKGM…NPQSQ → RAEKASQTLTSFGMKMETLL PEATMEQ in isoform 2. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_003690469 – 530SNKGM…NPQSQ → SSLSLSWRLFMLREASCHGV RQTPGGAHMSVSRSRSFEAC QQPRE in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_003691469 – 530SNKGM…NPQSQ → RWGEKQFIHLKLS in isoform 5. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_003692469 – 530SNKGM…NPQSQ → RYAP in isoform 6. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_055746469 – 474SNKGME → RSCVYK in isoform 9. Curated6
Alternative sequenceiVSP_055747475 – 530Missing in isoform 9. CuratedAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006590 mRNA. Translation: BAA24953.1.
AF051427 mRNA. Translation: AAC05985.1.
AF051428 mRNA. Translation: AAC05751.1.
AF061054 mRNA. Translation: AAC39784.1.
AF061055 mRNA. Translation: AAC39785.1.
AF060555 mRNA. Translation: AAC15234.1.
AF124790 mRNA. Translation: AAD32580.1.
AF047463 mRNA. Translation: AAC03786.1.
AB006589 mRNA. Translation: BAA31966.1.
DQ838582 mRNA. Translation: ABH09189.1.
DQ838583 mRNA. Translation: ABH09190.1.
AY785359 Genomic DNA. Translation: AAV31779.1.
AK292370 mRNA. Translation: BAF85059.1.
AL161756 Genomic DNA. No translation available.
AL355094 Genomic DNA. No translation available.
AL359235 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80850.1.
BC024181 mRNA. Translation: AAH24181.1.
AF191544 Genomic DNA. No translation available.
X99101 mRNA. Translation: CAA67555.1. Different initiation.
AF074598 mRNA. Translation: AAC25602.1.
AF074599 mRNA. Translation: AAC25603.1.
CCDSiCCDS32096.1. [Q92731-2]
CCDS55920.1. [Q92731-5]
CCDS61469.1. [Q92731-7]
CCDS61470.1. [Q92731-9]
CCDS9762.1. [Q92731-1]
PIRiJC5939.
PW0044.
S71400.
RefSeqiNP_001035365.1. NM_001040275.1. [Q92731-2]
NP_001201831.1. NM_001214902.1. [Q92731-5]
NP_001258805.1. NM_001271876.1. [Q92731-9]
NP_001258806.1. NM_001271877.1. [Q92731-7]
NP_001278641.1. NM_001291712.1. [Q92731-2]
NP_001278652.1. NM_001291723.1. [Q92731-2]
NP_001428.1. NM_001437.2. [Q92731-1]
XP_016876568.1. XM_017021079.1. [Q92731-1]
XP_016876569.1. XM_017021080.1. [Q92731-1]
XP_016876570.1. XM_017021081.1. [Q92731-1]
XP_016876571.1. XM_017021082.1. [Q92731-1]
XP_016876572.1. XM_017021083.1. [Q92731-1]
XP_016876573.1. XM_017021084.1. [Q92731-2]
UniGeneiHs.660607.
Hs.734038.
Hs.734416.

Genome annotation databases

EnsembliENST00000267525; ENSP00000267525; ENSG00000140009. [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009. [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009. [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009. [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009. [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009. [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009. [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009. [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009. [Q92731-6]
GeneIDi2100.
KEGGihsa:2100.
UCSCiuc001xgu.4. human. [Q92731-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Wikipedia

Estrogen receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006590 mRNA. Translation: BAA24953.1.
AF051427 mRNA. Translation: AAC05985.1.
AF051428 mRNA. Translation: AAC05751.1.
AF061054 mRNA. Translation: AAC39784.1.
AF061055 mRNA. Translation: AAC39785.1.
AF060555 mRNA. Translation: AAC15234.1.
AF124790 mRNA. Translation: AAD32580.1.
AF047463 mRNA. Translation: AAC03786.1.
AB006589 mRNA. Translation: BAA31966.1.
DQ838582 mRNA. Translation: ABH09189.1.
DQ838583 mRNA. Translation: ABH09190.1.
AY785359 Genomic DNA. Translation: AAV31779.1.
AK292370 mRNA. Translation: BAF85059.1.
AL161756 Genomic DNA. No translation available.
AL355094 Genomic DNA. No translation available.
AL359235 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80850.1.
BC024181 mRNA. Translation: AAH24181.1.
AF191544 Genomic DNA. No translation available.
X99101 mRNA. Translation: CAA67555.1. Different initiation.
AF074598 mRNA. Translation: AAC25602.1.
AF074599 mRNA. Translation: AAC25603.1.
CCDSiCCDS32096.1. [Q92731-2]
CCDS55920.1. [Q92731-5]
CCDS61469.1. [Q92731-7]
CCDS61470.1. [Q92731-9]
CCDS9762.1. [Q92731-1]
PIRiJC5939.
PW0044.
S71400.
RefSeqiNP_001035365.1. NM_001040275.1. [Q92731-2]
NP_001201831.1. NM_001214902.1. [Q92731-5]
NP_001258805.1. NM_001271876.1. [Q92731-9]
NP_001258806.1. NM_001271877.1. [Q92731-7]
NP_001278641.1. NM_001291712.1. [Q92731-2]
NP_001278652.1. NM_001291723.1. [Q92731-2]
NP_001428.1. NM_001437.2. [Q92731-1]
XP_016876568.1. XM_017021079.1. [Q92731-1]
XP_016876569.1. XM_017021080.1. [Q92731-1]
XP_016876570.1. XM_017021081.1. [Q92731-1]
XP_016876571.1. XM_017021082.1. [Q92731-1]
XP_016876572.1. XM_017021083.1. [Q92731-1]
XP_016876573.1. XM_017021084.1. [Q92731-2]
UniGeneiHs.660607.
Hs.734038.
Hs.734416.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
DisProtiDP00079.
ProteinModelPortaliQ92731.
SMRiQ92731.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108404. 100 interactors.
DIPiDIP-5966N.
IntActiQ92731. 424 interactors.
STRINGi9606.ENSP00000343925.

Chemistry databases

BindingDBiQ92731.
ChEMBLiCHEMBL242.
DrugBankiDB00255. Diethylstilbestrol.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB04574. Estropipate.
DB00481. Raloxifene.
DB00675. Tamoxifen.
DB01108. Trilostane.
GuidetoPHARMACOLOGYi621.

PTM databases

iPTMnetiQ92731.
PhosphoSitePlusiQ92731.
SwissPalmiQ92731.

Polymorphism and mutation databases

BioMutaiESR2.
DMDMi6166154.

Proteomic databases

PaxDbiQ92731.
PeptideAtlasiQ92731.
PRIDEiQ92731.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267525; ENSP00000267525; ENSG00000140009. [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009. [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009. [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009. [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009. [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009. [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009. [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009. [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009. [Q92731-6]
GeneIDi2100.
KEGGihsa:2100.
UCSCiuc001xgu.4. human. [Q92731-1]

Organism-specific databases

CTDi2100.
DisGeNETi2100.
GeneCardsiESR2.
HGNCiHGNC:3468. ESR2.
HPAiCAB022544.
MIMi601663. gene.
neXtProtiNX_Q92731.
OpenTargetsiENSG00000140009.
PharmGKBiPA27886.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00760000118887.
HOVERGENiHBG108344.
InParanoidiQ92731.
KOiK08551.
OMAiEPQKSPW.
OrthoDBiEOG091G03V4.
PhylomeDBiQ92731.
TreeFamiTF323751.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140009-MONOMER.
ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiQ92731.
SIGNORiQ92731.

Miscellaneous databases

EvolutionaryTraceiQ92731.
GeneWikiiEstrogen_receptor_beta.
GenomeRNAii2100.
PMAP-CutDBA8K8K5.
PROiQ92731.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140009.
ExpressionAtlasiQ92731. baseline and differential.
GenevisibleiQ92731. HS.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR028355. ER-beta/gamma.
IPR021064. Estrogen_rcpt_beta_N.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR024178. Oest_rcpt/oest-rel_rcp.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF12497. ERbeta_N. 1 hit.
PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PIRSFiPIRSF500102. ER-b. 1 hit.
PIRSF002527. ER-like_NR. 1 hit.
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiESR2_HUMAN
AccessioniPrimary (citable) accession number: Q92731
Secondary accession number(s): A8K8K5
, G3V5M5, O60608, O60685, O60702, O60703, O75583, O75584, Q0MWT5, Q0MWT6, Q86Z31, Q9UEV6, Q9UHD3, Q9UQK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 15, 1999
Last modified: November 30, 2016
This is version 198 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.