Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Estrogen receptor beta

Gene

ESR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi149 – 214Nuclear receptorPROSITE-ProRule annotationAdd BLAST66
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

  • core promoter sequence-specific DNA binding Source: UniProtKB
  • DNA binding Source: ProtInc
  • DNA binding transcription factor activity Source: ProtInc
  • enzyme binding Source: UniProtKB
  • estrogen receptor activity Source: CAFA
  • estrogen response element binding Source: CAFA
  • identical protein binding Source: IntAct
  • nuclear receptor activity Source: UniProtKB
  • receptor antagonist activity Source: UniProtKB
  • RNA polymerase II transcription factor activity, estrogen-activated sequence-specific DNA binding Source: ParkinsonsUK-UCL
  • RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
  • steroid binding Source: UniProtKB
  • steroid hormone receptor activity Source: ProtInc
  • transcription coactivator activity Source: ProtInc
  • zinc ion binding Source: InterPro

GO - Biological processi

  • cell-cell signaling Source: ProtInc
  • cellular response to estradiol stimulus Source: CAFA
  • intracellular estrogen receptor signaling pathway Source: CAFA
  • negative regulation of cell growth Source: UniProtKB
  • negative regulation of transcription by RNA polymerase II Source: UniProtKB
  • positive regulation of DNA binding transcription factor activity Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription by RNA polymerase II Source: CAFA
  • regulation of transcription, DNA-templated Source: UniProtKB
  • signal transduction Source: ProtInc
  • transcription initiation from RNA polymerase II promoter Source: Reactome

Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandLipid-binding, Metal-binding, Steroid-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-1257604 PIP3 activates AKT signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SignaLinkiQ92731
SIGNORiQ92731

Names & Taxonomyi

Protein namesi
Recommended name:
Estrogen receptor beta
Short name:
ER-beta
Alternative name(s):
Nuclear receptor subfamily 3 group A member 2
Gene namesi
Name:ESR2
Synonyms:ESTRB, NR3A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000140009.18
HGNCiHGNC:3468 ESR2
MIMi601663 gene
neXtProtiNX_Q92731

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi87S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-105. 1 Publication1
Mutagenesisi87S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-105. 1 Publication1
Mutagenesisi105S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-87. 1 Publication1
Mutagenesisi105S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-87. 1 Publication1

Organism-specific databases

DisGeNETi2100
MalaCardsiESR2
OpenTargetsiENSG00000140009
PharmGKBiPA27886

Chemistry databases

ChEMBLiCHEMBL242
DrugBankiDB07119 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB07032 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL
DB06875 3-(3-FLUORO-4-HYDROXYPHENYL)-7-HYDROXY-1-NAPHTHONITRILE
DB07236 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB07150 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB07198 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927 [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB04468 Afimoxifene
DB05882 CHF 4227
DB00255 Diethylstilbestrol
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB04574 Estrone sulfate
DB01645 Genistein
DB06202 Lasofoxifene
DB05052 MF101
DB02983 Para-Mercury-Benzenesulfonic Acid
DB01708 Prasterone
DB00481 Raloxifene
DB00675 Tamoxifen
DB01108 Trilostane
GuidetoPHARMACOLOGYi621

Polymorphism and mutation databases

BioMutaiESR2
DMDMi6166154

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000536421 – 530Estrogen receptor betaAdd BLAST530

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei87Phosphoserine1 Publication1
Modified residuei105Phosphoserine1 Publication1

Post-translational modificationi

Phosphorylation at Ser-87 and Ser-105 recruits NCOA1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ92731
PeptideAtlasiQ92731
PRIDEiQ92731

PTM databases

iPTMnetiQ92731
PhosphoSitePlusiQ92731
SwissPalmiQ92731

Miscellaneous databases

PMAP-CutDBiA8K8K5

Expressioni

Tissue specificityi

Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors. Isoform 2 is expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus. Isoform 4 is found in testis. Isoform 5 is expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus. Isoform 6 is expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain.

Gene expression databases

BgeeiENSG00000140009
ExpressionAtlasiQ92731 baseline and differential
GenevisibleiQ92731 HS

Organism-specific databases

HPAiCAB022544

Interactioni

Subunit structurei

Binds DNA as a homodimer. Can form a heterodimer with ESR1. Interacts with NCOA1, NCOA3, NCOA5 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Interacts with PELP1 and UBE1C. Isoform 2 preferentially forms a heterodimer with ESR1 rather than ESR2 and inhibits DNA-binding by ESR1. Interacts with AKAP13. Interacts with DNTTIP2. Interacts with isoform 4 of TXNRD1. Interacts with CCDC62 in the presence of estradiol/E2; this interaction seems to enhance the transcription of target genes, including cyclin-D1/CCND1 AP-1 promoter. Interacts with DNAAF4 (By similarity). Interacts with PRMT2. Interacts with CCAR2 (via N-terminus) in a ligand-independent manner.By similarity10 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • identical protein binding Source: IntAct
  • receptor antagonist activity Source: UniProtKB

Protein-protein interaction databases

BioGridi108404, 101 interactors
CORUMiQ92731
DIPiDIP-5966N
ELMiQ92731
IntActiQ92731, 431 interactors
MINTiQ92731
STRINGi9606.ENSP00000343925

Chemistry databases

BindingDBiQ92731

Structurei

Secondary structure

1530
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi257 – 260Combined sources4
Helixi261 – 263Combined sources3
Helixi265 – 275Combined sources11
Beta strandi286 – 288Combined sources3
Helixi291 – 314Combined sources24
Helixi319 – 321Combined sources3
Helixi324 – 347Combined sources24
Beta strandi348 – 350Combined sources3
Beta strandi353 – 357Combined sources5
Beta strandi359 – 363Combined sources5
Helixi364 – 369Combined sources6
Helixi373 – 389Combined sources17
Helixi394 – 406Combined sources13
Beta strandi407 – 409Combined sources3
Helixi411 – 413Combined sources3
Helixi417 – 419Combined sources3
Helixi421 – 442Combined sources22
Turni443 – 445Combined sources3
Helixi448 – 481Combined sources34
Beta strandi484 – 486Combined sources3
Helixi489 – 497Combined sources9
Helixi498 – 501Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
5TOAX-ray2.50A/B262-509[»]
DisProtiDP00079
ProteinModelPortaliQ92731
SMRiQ92731
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92731

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini264 – 498NR LBDPROSITE-ProRule annotationAdd BLAST235

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 148ModulatingAdd BLAST148

Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00760000118887
HOVERGENiHBG108344
InParanoidiQ92731
KOiK08551
OMAiEPQKSPW
OrthoDBiEOG091G03V4
PhylomeDBiQ92731
TreeFamiTF323751

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR028355 ER-beta/gamma
IPR021064 Estrogen_rcpt_beta_N
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR024178 Oest_rcpt/oest-rel_rcp
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF12497 ERbeta_N, 1 hit
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PIRSFiPIRSF500102 ER-b, 1 hit
PIRSF002527 ER-like_NR, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92731-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDIKNSPSSL NSPSSYNCSQ SILPLEHGSI YIPSSYVDSH HEYPAMTFYS
60 70 80 90 100
PAVMNYSIPS NVTNLEGGPG RQTTSPNVLW PTPGHLSPLV VHRQLSHLYA
110 120 130 140 150
EPQKSPWCEA RSLEHTLPVN RETLKRKVSG NRCASPVTGP GSKRDAHFCA
160 170 180 190 200
VCSDYASGYH YGVWSCEGCK AFFKRSIQGH NDYICPATNQ CTIDKNRRKS
210 220 230 240 250
CQACRLRKCY EVGMVKCGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGG
260 270 280 290 300
HAPRVRELLL DALSPEQLVL TLLEAEPPHV LISRPSAPFT EASMMMSLTK
310 320 330 340 350
LADKELVHMI SWAKKIPGFV ELSLFDQVRL LESCWMEVLM MGLMWRSIDH
360 370 380 390 400
PGKLIFAPDL VLDRDEGKCV EGILEIFDML LATTSRFREL KLQHKEYLCV
410 420 430 440 450
KAMILLNSSM YPLVTATQDA DSSRKLAHLL NAVTDALVWV IAKSGISSQQ
460 470 480 490 500
QSMRLANLLM LLSHVRHASN KGMEHLLNMK CKNVVPVYDL LLEMLNAHVL
510 520 530
RGCKSSITGS ECSPAEDSKS KEGSQNPQSQ
Length:530
Mass (Da):59,216
Last modified:July 15, 1999 - v2
Checksum:i8CAE34215992418A
GO
Isoform 2 (identifier: Q92731-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2, CX

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → RAEKASQTLTSFGMKMETLLPEATMEQ

Show »
Length:495
Mass (Da):55,483
Checksum:iF068DBC63DC838A6
GO
Isoform 3 (identifier: Q92731-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2A

The sequence of this isoform differs from the canonical sequence as follows:
     319-323: FVELS → MRGNA
     324-530: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:323
Mass (Da):35,944
Checksum:i158D376C56D3CA12
GO
Isoform 4 (identifier: Q92731-4) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → SSLSLSWRLF...SFEACQQPRE

Show »
Length:513
Mass (Da):57,518
Checksum:iEE88C42CBB24775E
GO
Isoform 5 (identifier: Q92731-5) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RWGEKQFIHLKLS

Note: Does not form homodimers.
Show »
Length:481
Mass (Da):54,096
Checksum:i9B6017FE950720F0
GO
Isoform 6 (identifier: Q92731-6) [UniParc]FASTAAdd to basket
Also known as: Beta-5

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RYAP

Note: Does not form homodimers.
Show »
Length:472
Mass (Da):52,959
Checksum:i673B0DB5FAF03C26
GO
Isoform 7 (identifier: Q92731-7) [UniParc]FASTAAdd to basket
Also known as: Beta-5A

The sequence of this isoform differs from the canonical sequence as follows:
     319-409: Missing.

Show »
Length:439
Mass (Da):48,614
Checksum:i35B686E3C0D32D0F
GO
Isoform 8 (identifier: Q92731-8) [UniParc]FASTAAdd to basket
Also known as: Beta-6

The sequence of this isoform differs from the canonical sequence as follows:
     365-375: DEGKCVEGILE → YVPSGHSDPGC
     376-530: Missing.

Show »
Length:375
Mass (Da):41,948
Checksum:iE2FA83EE3C519EE5
GO
Isoform 9 (identifier: Q92731-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-474: SNKGME → RSCVYK
     475-530: Missing.

Show »
Length:474
Mass (Da):53,209
Checksum:i4558F2986355FAF0
GO

Sequence cautioni

The sequence CAA67555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003685319 – 409Missing in isoform 7. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_003684319 – 323FVELS → MRGNA in isoform 3. 2 Publications5
Alternative sequenceiVSP_003686324 – 530Missing in isoform 3. 2 PublicationsAdd BLAST207
Alternative sequenceiVSP_003687365 – 375DEGKCVEGILE → YVPSGHSDPGC in isoform 8. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_003688376 – 530Missing in isoform 8. 1 PublicationAdd BLAST155
Alternative sequenceiVSP_003689469 – 530SNKGM…NPQSQ → RAEKASQTLTSFGMKMETLL PEATMEQ in isoform 2. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_003690469 – 530SNKGM…NPQSQ → SSLSLSWRLFMLREASCHGV RQTPGGAHMSVSRSRSFEAC QQPRE in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_003691469 – 530SNKGM…NPQSQ → RWGEKQFIHLKLS in isoform 5. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_003692469 – 530SNKGM…NPQSQ → RYAP in isoform 6. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_055746469 – 474SNKGME → RSCVYK in isoform 9. Curated6
Alternative sequenceiVSP_055747475 – 530Missing in isoform 9. CuratedAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006590 mRNA Translation: BAA24953.1
AF051427 mRNA Translation: AAC05985.1
AF051428 mRNA Translation: AAC05751.1
AF061054 mRNA Translation: AAC39784.1
AF061055 mRNA Translation: AAC39785.1
AF060555 mRNA Translation: AAC15234.1
AF124790 mRNA Translation: AAD32580.1
AF047463 mRNA Translation: AAC03786.1
AB006589 mRNA Translation: BAA31966.1
DQ838582 mRNA Translation: ABH09189.1
DQ838583 mRNA Translation: ABH09190.1
AY785359 Genomic DNA Translation: AAV31779.1
AK292370 mRNA Translation: BAF85059.1
AL161756 Genomic DNA No translation available.
AL355094 Genomic DNA No translation available.
AL359235 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80850.1
BC024181 mRNA Translation: AAH24181.1
AF191544 Genomic DNA No translation available.
X99101 mRNA Translation: CAA67555.1 Different initiation.
AF074598 mRNA Translation: AAC25602.1
AF074599 mRNA Translation: AAC25603.1
CCDSiCCDS32096.1 [Q92731-2]
CCDS55920.1 [Q92731-5]
CCDS61469.1 [Q92731-7]
CCDS61470.1 [Q92731-9]
CCDS9762.1 [Q92731-1]
PIRiJC5939
PW0044
S71400
RefSeqiNP_001035365.1, NM_001040275.1 [Q92731-2]
NP_001201831.1, NM_001214902.1 [Q92731-5]
NP_001258805.1, NM_001271876.1 [Q92731-9]
NP_001258806.1, NM_001271877.1 [Q92731-7]
NP_001278641.1, NM_001291712.1 [Q92731-2]
NP_001278652.1, NM_001291723.1 [Q92731-2]
NP_001428.1, NM_001437.2 [Q92731-1]
XP_016876568.1, XM_017021079.1 [Q92731-1]
XP_016876569.1, XM_017021080.1 [Q92731-1]
XP_016876570.1, XM_017021081.1 [Q92731-1]
XP_016876571.1, XM_017021082.1 [Q92731-1]
XP_016876572.1, XM_017021083.1 [Q92731-1]
XP_016876573.1, XM_017021084.1 [Q92731-2]
UniGeneiHs.660607
Hs.734038
Hs.734416

Genome annotation databases

EnsembliENST00000267525; ENSP00000267525; ENSG00000140009 [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009 [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009 [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009 [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009 [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009 [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009 [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009 [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009 [Q92731-6]
GeneIDi2100
KEGGihsa:2100
UCSCiuc001xgu.4 human [Q92731-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiESR2_HUMAN
AccessioniPrimary (citable) accession number: Q92731
Secondary accession number(s): A8K8K5
, G3V5M5, O60608, O60685, O60702, O60703, O75583, O75584, Q0MWT5, Q0MWT6, Q86Z31, Q9UEV6, Q9UHD3, Q9UQK9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 15, 1999
Last modified: March 28, 2018
This is version 210 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health