Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92637

- FCGRB_HUMAN

UniProt

Q92637 - FCGRB_HUMAN

Protein

High affinity immunoglobulin gamma Fc receptor IB

Gene

FCGR1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 1 (01 Feb 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.2 Publications

    GO - Molecular functioni

    1. immunoglobulin receptor activity Source: UniProtKB

    GO - Biological processi

    1. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
    2. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
    3. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
    4. cytokine-mediated signaling pathway Source: Reactome
    5. Fc receptor signaling pathway Source: GOC
    6. immune response Source: UniProtKB
    7. interferon-gamma-mediated signaling pathway Source: Reactome

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Adaptive immunity, Immunity

    Keywords - Ligandi

    IgG-binding protein

    Enzyme and pathway databases

    ReactomeiREACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
    REACT_25078. Interferon gamma signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    High affinity immunoglobulin gamma Fc receptor IB
    Short name:
    IgG Fc receptor IB
    Alternative name(s):
    Fc-gamma RIB
    Short name:
    FcRIB
    Short name:
    hFcgammaRIB
    Gene namesi
    Name:FCGR1B
    Synonyms:IGFRB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:3614. FCGR1B.

    Subcellular locationi

    Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

    GO - Cellular componenti

    1. clathrin-coated endocytic vesicle membrane Source: Reactome
    2. early endosome membrane Source: Reactome
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28061.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1515Sequence AnalysisAdd
    BLAST
    Chaini16 – 280265High affinity immunoglobulin gamma Fc receptor IBPRO_0000331462Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi43 ↔ 85PROSITE-ProRule annotation
    Glycosylationi59 – 591N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi124 ↔ 168PROSITE-ProRule annotation
    Glycosylationi152 – 1521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ92637.
    PRIDEiQ92637.

    PTM databases

    PhosphoSiteiQ92637.

    Expressioni

    Inductioni

    Up-regulated by IFNG/IFN-gamma.2 Publications

    Gene expression databases

    BgeeiQ92637.
    CleanExiHS_FCGR1B.
    GenevestigatoriQ92637.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000358391.

    Structurei

    3D structure databases

    ProteinModelPortaliQ92637.
    SMRiQ92637. Positions 21-195.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini16 – 198183ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini220 – 28061CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei199 – 21921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 10180Ig-like C2-type 1Add
    BLAST
    Domaini95 – 18490Ig-like C2-type 2Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG277652.
    HOGENOMiHOG000251632.
    HOVERGENiHBG051602.
    InParanoidiQ92637.
    OMAiLWCEGPR.
    PhylomeDBiQ92637.
    TreeFamiTF335097.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view]
    SMARTiSM00409. IG. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q92637-1) [UniParc]FASTAAdd to Basket

    Also known as: b2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWFLTTLLLW VPVDGQVDTT KAVITLQPPW VSVFQEETVT LHCEVLHLPG    50
    SSSTQWFLNG TATQTSTPSY RITSASVNDS GEYRCQRGLS GRSDPIQLEI 100
    HRGWLLLQVS SRVFMEGEPL ALRCHAWKDK LVYNVLYYRN GKAFKFFHWN 150
    SNLTILKTNI SHNGTYHCSG MGKHRYTSAG ISQYTVKGLQ LPTPVWFHVL 200
    FYLAVGIMFL VNTVLWVTIR KELKRKKKWN LEISLDSGHE KKVISSLQED 250
    RHLEEELKCQ EQKEEQLQEG VHRKEPQGAT 280
    Length:280
    Mass (Da):32,232
    Last modified:February 1, 1997 - v1
    Checksum:iC6C6C45AE3D345C6
    GO
    Isoform 2 (identifier: Q92637-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL
         224-280: Missing.

    Show »
    Length:224
    Mass (Da):25,203
    Checksum:iA7C9280734DB02A9
    GO
    Isoform 3 (identifier: Q92637-3) [UniParc]FASTAAdd to Basket

    Also known as: b3

    The sequence of this isoform differs from the canonical sequence as follows:
         11-102: Missing.

    Show »
    Length:188
    Mass (Da):22,136
    Checksum:iF46517B3279ABEF9
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti154 – 1541T → A in AAA35826. (PubMed:1430234)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei11 – 10292Missing in isoform 3. 1 PublicationVSP_033215Add
    BLAST
    Alternative sequencei188 – 22336GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2. CuratedVSP_033216Add
    BLAST
    Alternative sequencei224 – 28057Missing in isoform 2. CuratedVSP_033217Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L03419 mRNA. Translation: AAA35825.1.
    L03420 mRNA. Translation: AAA35826.1.
    S45709
    , S45704, S45705, S45707, S45708 Genomic DNA. Translation: AAD13842.1.
    AL357493 Genomic DNA. No translation available.
    CCDSiCCDS30820.1. [Q92637-3]
    CCDS30821.1. [Q92637-1]
    PIRiI55577.
    RefSeqiNP_001004340.2. NM_001004340.3. [Q92637-3]
    NP_001017986.1. NM_001017986.3. [Q92637-1]
    NP_001231839.1. NM_001244910.1. [Q92637-2]
    UniGeneiHs.534956.
    Hs.77424.

    Genome annotation databases

    EnsembliENST00000369383; ENSP00000358390; ENSG00000198019. [Q92637-3]
    ENST00000369384; ENSP00000358391; ENSG00000198019. [Q92637-1]
    GeneIDi2210.
    KEGGihsa:2210.
    UCSCiuc001eip.3. human. [Q92637-1]
    uc001eiq.3. human. [Q92637-3]
    uc009whr.2. human. [Q92637-2]

    Polymorphism databases

    DMDMi74760649.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L03419 mRNA. Translation: AAA35825.1 .
    L03420 mRNA. Translation: AAA35826.1 .
    S45709
    , S45704 , S45705 , S45707 , S45708 Genomic DNA. Translation: AAD13842.1 .
    AL357493 Genomic DNA. No translation available.
    CCDSi CCDS30820.1. [Q92637-3 ]
    CCDS30821.1. [Q92637-1 ]
    PIRi I55577.
    RefSeqi NP_001004340.2. NM_001004340.3. [Q92637-3 ]
    NP_001017986.1. NM_001017986.3. [Q92637-1 ]
    NP_001231839.1. NM_001244910.1. [Q92637-2 ]
    UniGenei Hs.534956.
    Hs.77424.

    3D structure databases

    ProteinModelPortali Q92637.
    SMRi Q92637. Positions 21-195.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000358391.

    PTM databases

    PhosphoSitei Q92637.

    Polymorphism databases

    DMDMi 74760649.

    Proteomic databases

    PaxDbi Q92637.
    PRIDEi Q92637.

    Protocols and materials databases

    DNASUi 2210.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000369383 ; ENSP00000358390 ; ENSG00000198019 . [Q92637-3 ]
    ENST00000369384 ; ENSP00000358391 ; ENSG00000198019 . [Q92637-1 ]
    GeneIDi 2210.
    KEGGi hsa:2210.
    UCSCi uc001eip.3. human. [Q92637-1 ]
    uc001eiq.3. human. [Q92637-3 ]
    uc009whr.2. human. [Q92637-2 ]

    Organism-specific databases

    CTDi 2210.
    GeneCardsi GC01M120926.
    H-InvDB HIX0028931.
    HGNCi HGNC:3614. FCGR1B.
    MIMi 601502. gene.
    neXtProti NX_Q92637.
    PharmGKBi PA28061.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG277652.
    HOGENOMi HOG000251632.
    HOVERGENi HBG051602.
    InParanoidi Q92637.
    OMAi LWCEGPR.
    PhylomeDBi Q92637.
    TreeFami TF335097.

    Enzyme and pathway databases

    Reactomei REACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
    REACT_25078. Interferon gamma signaling.

    Miscellaneous databases

    GenomeRNAii 2210.
    NextBioi 8951.
    PROi Q92637.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q92637.
    CleanExi HS_FCGR1B.
    Genevestigatori Q92637.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view ]
    SMARTi SM00409. IG. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Novel Fc gamma receptor I family gene products in human mononuclear cells."
      Porges A.J., Redecha P.B., Doebele R., Pan L.C., Salmon J.E., Kimberly R.P.
      J. Clin. Invest. 90:2102-2109(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY IFNG.
      Tissue: Blood.
    2. "Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure."
      Benech P.D., Sastry K.N., Iyer R.R., Eichbaum Q.G., Raveh D.P., Ezekowitz R.A.
      J. Exp. Med. 176:1115-1123(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION BY IFNG.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21."
      Maresco D.L., Chang E., Theil K.S., Francke U., Anderson C.L.
      Cytogenet. Cell Genet. 73:157-163(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    5. "Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts."
      Ernst L.K., Duchemin A.-M., Miller K.L., Anderson C.L.
      Mol. Immunol. 35:943-954(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ALTERNATIVE SPLICING.

    Entry informationi

    Entry nameiFCGRB_HUMAN
    AccessioniPrimary (citable) accession number: Q92637
    Secondary accession number(s): Q7KZ13, Q92638
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: February 1, 1997
    Last modified: October 1, 2014
    This is version 104 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3