Q92637 (FCGRB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: High affinity immunoglobulin gamma Fc receptor IB Short name=IgG Fc receptor IB Alternative name(s): Fc-gamma RIB Short name=FcRIB Short name=hFcgammaRIB | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 280 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response. Ref.1 Ref.5 |
| Subcellular location | |
| Induction | |
| Sequence similarities | Belongs to the immunoglobulin superfamily. FCGR1 family. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92637-1) Also known as: b2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92637-2) The sequence of this isoform differs from the canonical sequence as follows: 188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL 224-280: Missing. | ||||||
| Isoform 3 (identifier: Q92637-3) Also known as: b3; The sequence of this isoform differs from the canonical sequence as follows: 11-102: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 15 | 15 | Potential | ||||||||
| Chain | 16 – 280 | 265 | High affinity immunoglobulin gamma Fc receptor IB | PRO_0000331462 | |||||||
Regions | |||||||||||
| Topological domain | 16 – 198 | 183 | Extracellular Potential | ||||||||
| Transmembrane | 199 – 219 | 21 | Helical; Potential | ||||||||
| Topological domain | 220 – 280 | 61 | Cytoplasmic Potential | ||||||||
| Domain | 22 – 101 | 80 | Ig-like C2-type 1 | ||||||||
| Domain | 95 – 184 | 90 | Ig-like C2-type 2 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 59 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 152 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 43 ↔ 85 | By similarity | |||||||||
| Disulfide bond | 124 ↔ 168 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 11 – 102 | 92 | Missing in isoform 3. | VSP_033215 | |||||||
| Alternative sequence | 188 – 223 | 36 | GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2. | VSP_033216 | |||||||
| Alternative sequence | 224 – 280 | 57 | Missing in isoform 2. | VSP_033217 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 154 | 1 | T → A in AAA35826. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel Fc gamma receptor I family gene products in human mononuclear cells." Porges A.J., Redecha P.B., Doebele R., Pan L.C., Salmon J.E., Kimberly R.P. J. Clin. Invest. 90:2102-2109(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY IFNG. Tissue: Blood. |
| [2] | "Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure." Benech P.D., Sastry K.N., Iyer R.R., Eichbaum Q.G., Raveh D.P., Ezekowitz R.A. J. Exp. Med. 176:1115-1123(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION BY IFNG. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21." Maresco D.L., Chang E., Theil K.S., Francke U., Anderson C.L. Cytogenet. Cell Genet. 73:157-163(1996) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [5] | "Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts." Ernst L.K., Duchemin A.-M., Miller K.L., Anderson C.L. Mol. Immunol. 35:943-954(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L03419 mRNA. Translation: AAA35825.1. L03420 mRNA. Translation: AAA35826.1. S45709 S45708 Genomic DNA. Translation: AAD13842.1.AL357493 Genomic DNA. No translation available. |
| IPI | IPI00294221. IPI00383647. IPI00890744. |
| PIR | I55577. |
| RefSeq | NP_001004340.2. NM_001004340.3. NP_001017986.1. NM_001017986.3. NP_001231839.1. NM_001244910.1. |
| UniGene | Hs.534956. Hs.77424. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FNL based on UniProtKB O75015. |
| ProteinModelPortal | Q92637. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000358391. |
PTM databases | |
| PhosphoSite | Q92637. |
Polymorphism databases | |
| DMDM | 74760649. |
Proteomic databases | |
| PaxDb | Q92637. |
| PRIDE | Q92637. |
Protocols and materials databases | |
| DNASU | 2210. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000369383; ENSP00000358390; ENSG00000198019. ENST00000369384; ENSP00000358391; ENSG00000198019. ENST00000577333; ENSP00000464601; ENSG00000263850. |
| GeneID | 2210. |
| KEGG | hsa:2210. |
| UCSC | uc001eip.3. human. uc001eiq.3. human. uc009whr.2. human. |
Organism-specific databases | |
| CTD | 2210. |
| GeneCards | GC01M120926. |
| H-InvDB | HIX0028931. |
| HGNC | HGNC:3614. FCGR1B. |
| MIM | 601502. gene. |
| neXtProt | NX_Q92637. |
| PharmGKB | PA28061. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG277652. |
| HOGENOM | HOG000251632. |
| HOVERGEN | HBG051602. |
| InParanoid | Q92637. |
| OMA | LWCEGPR. |
| OrthoDB | EOG498V21. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Immune System. |
Gene expression databases | |
| Bgee | Q92637. |
| CleanEx | HS_FCGR1B. |
| Genevestigator | Q92637. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. [Graphical view] |
| SMART | SM00409. IG. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2210. |
| NextBio | 8951. |
| SOURCE | Search... |
Entry information
| Entry name | FCGRB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92637 Secondary accession number(s): Q7KZ13, Q92638 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
