Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92637

- FCGRB_HUMAN

UniProt

Q92637 - FCGRB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

High affinity immunoglobulin gamma Fc receptor IB

Gene

FCGR1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.2 Publications

GO - Molecular functioni

  1. immunoglobulin receptor activity Source: UniProtKB

GO - Biological processi

  1. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
  2. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
  3. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
  4. cytokine-mediated signaling pathway Source: Reactome
  5. Fc receptor signaling pathway Source: GOC
  6. immune response Source: UniProtKB
  7. interferon-gamma-mediated signaling pathway Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Keywords - Ligandi

IgG-binding protein

Enzyme and pathway databases

ReactomeiREACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
REACT_25078. Interferon gamma signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin gamma Fc receptor IB
Short name:
IgG Fc receptor IB
Alternative name(s):
Fc-gamma RIB
Short name:
FcRIB
Short name:
hFcgammaRIB
Gene namesi
Name:FCGR1B
Synonyms:IGFRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:3614. FCGR1B.

Subcellular locationi

Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini16 – 198183ExtracellularSequence AnalysisAdd
BLAST
Transmembranei199 – 21921HelicalSequence AnalysisAdd
BLAST
Topological domaini220 – 28061CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. clathrin-coated endocytic vesicle membrane Source: Reactome
  2. early endosome membrane Source: Reactome
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28061.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1515Sequence AnalysisAdd
BLAST
Chaini16 – 280265High affinity immunoglobulin gamma Fc receptor IBPRO_0000331462Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi43 ↔ 85PROSITE-ProRule annotation
Glycosylationi59 – 591N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi124 ↔ 168PROSITE-ProRule annotation
Glycosylationi152 – 1521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ92637.
PRIDEiQ92637.

PTM databases

PhosphoSiteiQ92637.

Expressioni

Inductioni

Up-regulated by IFNG/IFN-gamma.2 Publications

Gene expression databases

BgeeiQ92637.
CleanExiHS_FCGR1B.
GenevestigatoriQ92637.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000358391.

Structurei

3D structure databases

ProteinModelPortaliQ92637.
SMRiQ92637. Positions 21-195.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 10180Ig-like C2-type 1Add
BLAST
Domaini95 – 18490Ig-like C2-type 2Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG277652.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000251632.
HOVERGENiHBG051602.
InParanoidiQ92637.
OMAiLWCEGPR.
PhylomeDBiQ92637.
TreeFamiTF335097.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92637-1) [UniParc]FASTAAdd to Basket

Also known as: b2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWFLTTLLLW VPVDGQVDTT KAVITLQPPW VSVFQEETVT LHCEVLHLPG
60 70 80 90 100
SSSTQWFLNG TATQTSTPSY RITSASVNDS GEYRCQRGLS GRSDPIQLEI
110 120 130 140 150
HRGWLLLQVS SRVFMEGEPL ALRCHAWKDK LVYNVLYYRN GKAFKFFHWN
160 170 180 190 200
SNLTILKTNI SHNGTYHCSG MGKHRYTSAG ISQYTVKGLQ LPTPVWFHVL
210 220 230 240 250
FYLAVGIMFL VNTVLWVTIR KELKRKKKWN LEISLDSGHE KKVISSLQED
260 270 280
RHLEEELKCQ EQKEEQLQEG VHRKEPQGAT
Length:280
Mass (Da):32,232
Last modified:February 1, 1997 - v1
Checksum:iC6C6C45AE3D345C6
GO
Isoform 2 (identifier: Q92637-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL
     224-280: Missing.

Show »
Length:224
Mass (Da):25,203
Checksum:iA7C9280734DB02A9
GO
Isoform 3 (identifier: Q92637-3) [UniParc]FASTAAdd to Basket

Also known as: b3

The sequence of this isoform differs from the canonical sequence as follows:
     11-102: Missing.

Show »
Length:188
Mass (Da):22,136
Checksum:iF46517B3279ABEF9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti154 – 1541T → A in AAA35826. (PubMed:1430234)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei11 – 10292Missing in isoform 3. 1 PublicationVSP_033215Add
BLAST
Alternative sequencei188 – 22336GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2. CuratedVSP_033216Add
BLAST
Alternative sequencei224 – 28057Missing in isoform 2. CuratedVSP_033217Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA. Translation: AAA35825.1.
L03420 mRNA. Translation: AAA35826.1.
S45709
, S45704, S45705, S45707, S45708 Genomic DNA. Translation: AAD13842.1.
AL357493 Genomic DNA. No translation available.
CCDSiCCDS72844.1. [Q92637-2]
CCDS72845.1. [Q92637-1]
CCDS72846.1. [Q92637-3]
PIRiI55577.
RefSeqiNP_001004340.2. NM_001004340.3. [Q92637-3]
NP_001017986.1. NM_001017986.3. [Q92637-1]
NP_001231839.1. NM_001244910.1. [Q92637-2]
UniGeneiHs.534956.
Hs.77424.

Genome annotation databases

EnsembliENST00000369383; ENSP00000358390; ENSG00000198019. [Q92637-3]
GeneIDi2210.
KEGGihsa:2210.
UCSCiuc001eip.3. human. [Q92637-1]
uc001eiq.3. human. [Q92637-3]
uc009whr.2. human. [Q92637-2]

Polymorphism databases

DMDMi74760649.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA. Translation: AAA35825.1 .
L03420 mRNA. Translation: AAA35826.1 .
S45709
, S45704 , S45705 , S45707 , S45708 Genomic DNA. Translation: AAD13842.1 .
AL357493 Genomic DNA. No translation available.
CCDSi CCDS72844.1. [Q92637-2 ]
CCDS72845.1. [Q92637-1 ]
CCDS72846.1. [Q92637-3 ]
PIRi I55577.
RefSeqi NP_001004340.2. NM_001004340.3. [Q92637-3 ]
NP_001017986.1. NM_001017986.3. [Q92637-1 ]
NP_001231839.1. NM_001244910.1. [Q92637-2 ]
UniGenei Hs.534956.
Hs.77424.

3D structure databases

ProteinModelPortali Q92637.
SMRi Q92637. Positions 21-195.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000358391.

Chemistry

DrugBanki DB00028. Intravenous Immunoglobulin.

PTM databases

PhosphoSitei Q92637.

Polymorphism databases

DMDMi 74760649.

Proteomic databases

PaxDbi Q92637.
PRIDEi Q92637.

Protocols and materials databases

DNASUi 2210.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000369383 ; ENSP00000358390 ; ENSG00000198019 . [Q92637-3 ]
GeneIDi 2210.
KEGGi hsa:2210.
UCSCi uc001eip.3. human. [Q92637-1 ]
uc001eiq.3. human. [Q92637-3 ]
uc009whr.2. human. [Q92637-2 ]

Organism-specific databases

CTDi 2210.
GeneCardsi GC01M120926.
H-InvDB HIX0028931.
HGNCi HGNC:3614. FCGR1B.
MIMi 601502. gene.
neXtProti NX_Q92637.
PharmGKBi PA28061.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG277652.
GeneTreei ENSGT00760000119130.
HOGENOMi HOG000251632.
HOVERGENi HBG051602.
InParanoidi Q92637.
OMAi LWCEGPR.
PhylomeDBi Q92637.
TreeFami TF335097.

Enzyme and pathway databases

Reactomei REACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
REACT_25078. Interferon gamma signaling.

Miscellaneous databases

GenomeRNAii 2210.
NextBioi 8951.
PROi Q92637.
SOURCEi Search...

Gene expression databases

Bgeei Q92637.
CleanExi HS_FCGR1B.
Genevestigatori Q92637.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view ]
SMARTi SM00409. IG. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel Fc gamma receptor I family gene products in human mononuclear cells."
    Porges A.J., Redecha P.B., Doebele R., Pan L.C., Salmon J.E., Kimberly R.P.
    J. Clin. Invest. 90:2102-2109(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY IFNG.
    Tissue: Blood.
  2. "Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure."
    Benech P.D., Sastry K.N., Iyer R.R., Eichbaum Q.G., Raveh D.P., Ezekowitz R.A.
    J. Exp. Med. 176:1115-1123(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION BY IFNG.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21."
    Maresco D.L., Chang E., Theil K.S., Francke U., Anderson C.L.
    Cytogenet. Cell Genet. 73:157-163(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  5. "Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts."
    Ernst L.K., Duchemin A.-M., Miller K.L., Anderson C.L.
    Mol. Immunol. 35:943-954(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ALTERNATIVE SPLICING.

Entry informationi

Entry nameiFCGRB_HUMAN
AccessioniPrimary (citable) accession number: Q92637
Secondary accession number(s): Q7KZ13, Q92638
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: February 1, 1997
Last modified: October 29, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3