Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q92637 (FCGRB_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
High affinity immunoglobulin gamma Fc receptor IB

Short name=IgG Fc receptor IB
Alternative name(s):
Fc-gamma RIB
Short name=FcRIB
Short name=hFcgammaRIB
Gene names
Name:FCGR1B
Synonyms:IGFRB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length280 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response. Ref.1 Ref.5

Subcellular location

Cell membrane; Single-pass type I membrane protein Ref.1.

Induction

Up-regulated by IFNG/IFN-gamma. Ref.1 Ref.2

Sequence similarities

Belongs to the immunoglobulin superfamily. FCGR1 family.

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Ontologies

Keywords
   Biological processAdaptive immunity
Immunity
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   LigandIgG-binding protein
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processFc receptor signaling pathway

Non-traceable author statement Ref.1. Source: GOC

antigen processing and presentation of exogenous peptide antigen via MHC class I

Traceable author statement. Source: Reactome

antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent

Traceable author statement. Source: Reactome

antigen processing and presentation of peptide antigen via MHC class I

Traceable author statement. Source: Reactome

cytokine-mediated signaling pathway

Traceable author statement. Source: Reactome

immune response

Non-traceable author statement Ref.1. Source: UniProtKB

interferon-gamma-mediated signaling pathway

Traceable author statement. Source: Reactome

   Cellular_componentclathrin-coated endocytic vesicle membrane

Traceable author statement. Source: Reactome

early endosome membrane

Traceable author statement. Source: Reactome

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Non-traceable author statement Ref.1. Source: UniProtKB

   Molecular_functionimmunoglobulin receptor activity

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q92637-1)

Also known as: b2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q92637-2)

The sequence of this isoform differs from the canonical sequence as follows:
     188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL
     224-280: Missing.
Isoform 3 (identifier: Q92637-3)

Also known as: b3;

The sequence of this isoform differs from the canonical sequence as follows:
     11-102: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1515 Potential
Chain16 – 280265High affinity immunoglobulin gamma Fc receptor IB
PRO_0000331462

Regions

Topological domain16 – 198183Extracellular Potential
Transmembrane199 – 21921Helical; Potential
Topological domain220 – 28061Cytoplasmic Potential
Domain22 – 10180Ig-like C2-type 1
Domain95 – 18490Ig-like C2-type 2

Amino acid modifications

Glycosylation591N-linked (GlcNAc...) Potential
Glycosylation1521N-linked (GlcNAc...) Potential
Glycosylation1631N-linked (GlcNAc...) Potential
Disulfide bond43 ↔ 85 By similarity
Disulfide bond124 ↔ 168 By similarity

Natural variations

Alternative sequence11 – 10292Missing in isoform 3.
VSP_033215
Alternative sequence188 – 22336GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2.
VSP_033216
Alternative sequence224 – 28057Missing in isoform 2.
VSP_033217

Experimental info

Sequence conflict1541T → A in AAA35826. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (b2) [UniParc].

Last modified February 1, 1997. Version 1.
Checksum: C6C6C45AE3D345C6

FASTA28032,232
        10         20         30         40         50         60 
MWFLTTLLLW VPVDGQVDTT KAVITLQPPW VSVFQEETVT LHCEVLHLPG SSSTQWFLNG 

        70         80         90        100        110        120 
TATQTSTPSY RITSASVNDS GEYRCQRGLS GRSDPIQLEI HRGWLLLQVS SRVFMEGEPL 

       130        140        150        160        170        180 
ALRCHAWKDK LVYNVLYYRN GKAFKFFHWN SNLTILKTNI SHNGTYHCSG MGKHRYTSAG 

       190        200        210        220        230        240 
ISQYTVKGLQ LPTPVWFHVL FYLAVGIMFL VNTVLWVTIR KELKRKKKWN LEISLDSGHE 

       250        260        270        280 
KKVISSLQED RHLEEELKCQ EQKEEQLQEG VHRKEPQGAT 

« Hide

Isoform 2 [UniParc].

Checksum: A7C9280734DB02A9
Show »

FASTA22425,203
Isoform 3 (b3) [UniParc].

Checksum: F46517B3279ABEF9
Show »

FASTA18822,136

References

« Hide 'large scale' references
[1]"Novel Fc gamma receptor I family gene products in human mononuclear cells."
Porges A.J., Redecha P.B., Doebele R., Pan L.C., Salmon J.E., Kimberly R.P.
J. Clin. Invest. 90:2102-2109(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, SUBCELLULAR LOCATION, INDUCTION BY IFNG.
Tissue: Blood.
[2]"Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure."
Benech P.D., Sastry K.N., Iyer R.R., Eichbaum Q.G., Raveh D.P., Ezekowitz R.A.
J. Exp. Med. 176:1115-1123(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION BY IFNG.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21."
Maresco D.L., Chang E., Theil K.S., Francke U., Anderson C.L.
Cytogenet. Cell Genet. 73:157-163(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[5]"Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts."
Ernst L.K., Duchemin A.-M., Miller K.L., Anderson C.L.
Mol. Immunol. 35:943-954(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, ALTERNATIVE SPLICING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L03419 mRNA. Translation: AAA35825.1.
L03420 mRNA. Translation: AAA35826.1.
S45709 expand/collapse EMBL AC list , S45704, S45705, S45707, S45708 Genomic DNA. Translation: AAD13842.1.
AL357493 Genomic DNA. No translation available.
CCDSCCDS30820.1. [Q92637-3]
CCDS30821.1. [Q92637-1]
PIRI55577.
RefSeqNP_001004340.2. NM_001004340.3. [Q92637-3]
NP_001017986.1. NM_001017986.3. [Q92637-1]
NP_001231839.1. NM_001244910.1. [Q92637-2]
UniGeneHs.534956.
Hs.77424.

3D structure databases

ProteinModelPortalQ92637.
SMRQ92637. Positions 21-195.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000358391.

PTM databases

PhosphoSiteQ92637.

Polymorphism databases

DMDM74760649.

Proteomic databases

PaxDbQ92637.
PRIDEQ92637.

Protocols and materials databases

DNASU2210.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000369383; ENSP00000358390; ENSG00000198019. [Q92637-3]
ENST00000369384; ENSP00000358391; ENSG00000198019. [Q92637-1]
ENST00000577333; ENSP00000464601; ENSG00000263850. [Q92637-3]
GeneID2210.
KEGGhsa:2210.
UCSCuc001eip.3. human. [Q92637-1]
uc001eiq.3. human. [Q92637-3]
uc009whr.2. human. [Q92637-2]

Organism-specific databases

CTD2210.
GeneCardsGC01M120926.
H-InvDBHIX0028931.
HGNCHGNC:3614. FCGR1B.
MIM601502. gene.
neXtProtNX_Q92637.
PharmGKBPA28061.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG277652.
HOGENOMHOG000251632.
HOVERGENHBG051602.
InParanoidQ92637.
OMALWCEGPR.
PhylomeDBQ92637.
TreeFamTF335097.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.

Gene expression databases

BgeeQ92637.
CleanExHS_FCGR1B.
GenevestigatorQ92637.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTSM00409. IG. 2 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi2210.
NextBio8951.
PROQ92637.
SOURCESearch...

Entry information

Entry nameFCGRB_HUMAN
AccessionPrimary (citable) accession number: Q92637
Secondary accession number(s): Q7KZ13, Q92638
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: February 1, 1997
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM