Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity immunoglobulin gamma Fc receptor IB

Gene

FCGR1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.2 Publications

GO - Molecular functioni

  • immunoglobulin receptor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Keywords - Ligandi

IgG-binding protein

Enzyme and pathway databases

BioCyciZFISH:G66-31995-MONOMER.
ReactomeiR-HSA-1236978. Cross-presentation of soluble exogenous antigens (endosomes).
R-HSA-877300. Interferon gamma signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin gamma Fc receptor IB
Short name:
IgG Fc receptor IB
Alternative name(s):
Fc-gamma RIB
Short name:
FcRIB
Short name:
hFcgammaRIB
Gene namesi
Name:FCGR1B
Synonyms:IGFRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:3614. FCGR1B.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini16 – 198ExtracellularSequence analysisAdd BLAST183
Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 280CytoplasmicSequence analysisAdd BLAST61

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2210.
OpenTargetsiENSG00000198019.
PharmGKBiPA28061.

Chemistry databases

DrugBankiDB00028. Intravenous Immunoglobulin.

Polymorphism and mutation databases

BioMutaiFCGR1B.
DMDMi74760649.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000033146216 – 280High affinity immunoglobulin gamma Fc receptor IBAdd BLAST265

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi43 ↔ 85PROSITE-ProRule annotation
Glycosylationi59N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi124 ↔ 168PROSITE-ProRule annotation
Glycosylationi152N-linked (GlcNAc...)Sequence analysis1
Glycosylationi163N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ92637.
PeptideAtlasiQ92637.
PRIDEiQ92637.

PTM databases

iPTMnetiQ92637.
PhosphoSitePlusiQ92637.

Expressioni

Inductioni

Up-regulated by IFNG/IFN-gamma.2 Publications

Gene expression databases

BgeeiENSG00000198019.
CleanExiHS_FCGR1B.
ExpressionAtlasiQ92637. baseline and differential.
GenevisibleiQ92637. HS.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000358391.

Structurei

3D structure databases

ProteinModelPortaliQ92637.
SMRiQ92637.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 101Ig-like C2-type 1Add BLAST80
Domaini95 – 184Ig-like C2-type 2Add BLAST90

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVK2. Eukaryota.
ENOG410YF57. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000251632.
HOVERGENiHBG051602.
InParanoidiQ92637.
PhylomeDBiQ92637.
TreeFamiTF335097.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92637-1) [UniParc]FASTAAdd to basket
Also known as: b2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWFLTTLLLW VPVDGQVDTT KAVITLQPPW VSVFQEETVT LHCEVLHLPG
60 70 80 90 100
SSSTQWFLNG TATQTSTPSY RITSASVNDS GEYRCQRGLS GRSDPIQLEI
110 120 130 140 150
HRGWLLLQVS SRVFMEGEPL ALRCHAWKDK LVYNVLYYRN GKAFKFFHWN
160 170 180 190 200
SNLTILKTNI SHNGTYHCSG MGKHRYTSAG ISQYTVKGLQ LPTPVWFHVL
210 220 230 240 250
FYLAVGIMFL VNTVLWVTIR KELKRKKKWN LEISLDSGHE KKVISSLQED
260 270 280
RHLEEELKCQ EQKEEQLQEG VHRKEPQGAT
Length:280
Mass (Da):32,232
Last modified:February 1, 1997 - v1
Checksum:iC6C6C45AE3D345C6
GO
Isoform 2 (identifier: Q92637-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL
     224-280: Missing.

Show »
Length:224
Mass (Da):25,203
Checksum:iA7C9280734DB02A9
GO
Isoform 3 (identifier: Q92637-3) [UniParc]FASTAAdd to basket
Also known as: b3

The sequence of this isoform differs from the canonical sequence as follows:
     11-102: Missing.

Show »
Length:188
Mass (Da):22,136
Checksum:iF46517B3279ABEF9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti154T → A in AAA35826 (PubMed:1430234).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03321511 – 102Missing in isoform 3. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033216188 – 223GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2. CuratedAdd BLAST36
Alternative sequenceiVSP_033217224 – 280Missing in isoform 2. CuratedAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA. Translation: AAA35825.1.
L03420 mRNA. Translation: AAA35826.1.
S45709
, S45704, S45705, S45707, S45708 Genomic DNA. Translation: AAD13842.1.
AL357493 Genomic DNA. No translation available.
CCDSiCCDS72844.1. [Q92637-2]
CCDS72845.1. [Q92637-1]
CCDS72846.1. [Q92637-3]
PIRiI55577.
RefSeqiNP_001004340.2. NM_001004340.3. [Q92637-3]
NP_001017986.1. NM_001017986.3. [Q92637-1]
NP_001231839.1. NM_001244910.1. [Q92637-2]
UniGeneiHs.534956.

Genome annotation databases

EnsembliENST00000369383; ENSP00000358390; ENSG00000198019. [Q92637-3]
GeneIDi2210.
KEGGihsa:2210.
UCSCiuc031upv.2. human. [Q92637-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA. Translation: AAA35825.1.
L03420 mRNA. Translation: AAA35826.1.
S45709
, S45704, S45705, S45707, S45708 Genomic DNA. Translation: AAD13842.1.
AL357493 Genomic DNA. No translation available.
CCDSiCCDS72844.1. [Q92637-2]
CCDS72845.1. [Q92637-1]
CCDS72846.1. [Q92637-3]
PIRiI55577.
RefSeqiNP_001004340.2. NM_001004340.3. [Q92637-3]
NP_001017986.1. NM_001017986.3. [Q92637-1]
NP_001231839.1. NM_001244910.1. [Q92637-2]
UniGeneiHs.534956.

3D structure databases

ProteinModelPortaliQ92637.
SMRiQ92637.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000358391.

Chemistry databases

DrugBankiDB00028. Intravenous Immunoglobulin.

PTM databases

iPTMnetiQ92637.
PhosphoSitePlusiQ92637.

Polymorphism and mutation databases

BioMutaiFCGR1B.
DMDMi74760649.

Proteomic databases

PaxDbiQ92637.
PeptideAtlasiQ92637.
PRIDEiQ92637.

Protocols and materials databases

DNASUi2210.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369383; ENSP00000358390; ENSG00000198019. [Q92637-3]
GeneIDi2210.
KEGGihsa:2210.
UCSCiuc031upv.2. human. [Q92637-1]

Organism-specific databases

CTDi2210.
DisGeNETi2210.
GeneCardsiFCGR1B.
H-InvDBHIX0028931.
HGNCiHGNC:3614. FCGR1B.
MIMi601502. gene.
neXtProtiNX_Q92637.
OpenTargetsiENSG00000198019.
PharmGKBiPA28061.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVK2. Eukaryota.
ENOG410YF57. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000251632.
HOVERGENiHBG051602.
InParanoidiQ92637.
PhylomeDBiQ92637.
TreeFamiTF335097.

Enzyme and pathway databases

BioCyciZFISH:G66-31995-MONOMER.
ReactomeiR-HSA-1236978. Cross-presentation of soluble exogenous antigens (endosomes).
R-HSA-877300. Interferon gamma signaling.

Miscellaneous databases

GenomeRNAii2210.
PROiQ92637.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198019.
CleanExiHS_FCGR1B.
ExpressionAtlasiQ92637. baseline and differential.
GenevisibleiQ92637. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFCGRB_HUMAN
AccessioniPrimary (citable) accession number: Q92637
Secondary accession number(s): Q7KZ13, Q92638
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: February 1, 1997
Last modified: November 2, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.