Q92636 (FAN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAN Alternative name(s): Factor associated with neutral sphingomyelinase activation Short name=Factor associated with N-SMase activation | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 917 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Couples the p55 TNF-receptor (TNF-R55 / TNFR1) to neutral sphingomyelinase (N-SMASE). Specifically binds to the N-smase activation domain of TNF-R55. May regulate ceramide production by N-SMASE. |
| Tissue specificity | Ubiquitous. |
| Sequence similarities | Contains 1 BEACH domain. Contains 1 GRAM domain. Contains 6 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | ceramide metabolic process Traceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Traceable author statement. Source: ProtInc soluble fractionTraceable author statement. Source: ProtInc |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct receptor signaling protein activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GABARAP | O95166 | 2 | EBI-2947053,EBI-712001 | |
| GABARAPL1 | Q9H0R8 | 6 | EBI-2947053,EBI-746969 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92636-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92636-2) The sequence of this isoform differs from the canonical sequence as follows: 1-20: MAFIRKKQQEQQLQLYSKER → MTGQARFHRGAEACRAIRQCRSRRPRAAHPEGRAGSGRGSRHASPGVRRGG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 917 | 917 | Protein FAN | PRO_0000050975 | |||||
Regions | |||||||||
| Domain | 176 – 247 | 72 | GRAM | ||||||
| Domain | 290 – 575 | 286 | BEACH | ||||||
| Repeat | 628 – 658 | 31 | WD 1 | ||||||
| Repeat | 670 – 700 | 31 | WD 2 | ||||||
| Repeat | 712 – 740 | 29 | WD 3 | ||||||
| Repeat | 761 – 791 | 31 | WD 4 | ||||||
| Repeat | 803 – 833 | 31 | WD 5 | ||||||
| Repeat | 884 – 914 | 31 | WD 6 | ||||||
| Compositional bias | 23 – 28 | 6 | Poly-Leu | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 20 | 20 | MAFIR…YSKER → MTGQARFHRGAEACRAIRQC RSRRPRAAHPEGRAGSGRGS RHASPGVRRGG in isoform 2. | VSP_042036 | |||||
| Natural variant | 626 | 1 | Y → C. Corresponds to variant rs2228505 [ dbSNP | Ensembl ]. | VAR_047023 | |||||
| Natural variant | 850 | 1 | R → T. Ref.1 Corresponds to variant rs1131173 [ dbSNP | Ensembl ]. | VAR_047024 | |||||
Experimental info | |||||||||
| Sequence conflict | 218 | 1 | T → A in BAG57371. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X96586 mRNA. Translation: CAA65405.1. AK294009 mRNA. Translation: BAG57371.1. AC068522 Genomic DNA. No translation available. AC092700 Genomic DNA. No translation available. CH471068 Genomic DNA. Translation: EAW86817.1. BC041124 mRNA. Translation: AAH41124.1. |
| IPI | IPI00328260. |
| RefSeq | NP_001138244.1. NM_001144772.1. NP_003571.2. NM_003580.3. |
| UniGene | Hs.372000. |
3D structure databases | |
| ProteinModelPortal | Q92636. |
| SMR | Q92636. Positions 192-575, 622-916. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q92636. 12 interactions. |
| MINT | MINT-2813141. |
| STRING | Q92636. |
PTM databases | |
| PhosphoSite | Q92636. |
Polymorphism databases | |
| DMDM | 209572614. |
Proteomic databases | |
| PRIDE | Q92636. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000038176; ENSP00000038176; ENSG00000035681. |
| GeneID | 8439. |
| KEGG | hsa:8439. |
Organism-specific databases | |
| CTD | 8439. |
| GeneCards | GC08M059496. |
| H-InvDB | HIX0007527. |
| HGNC | HGNC:8017. NSMAF. |
| HPA | HPA023067. HPA023148. HPA023151. |
| MIM | 603043. gene. |
| neXtProt | NX_Q92636. |
| PharmGKB | PA31795. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG12377. |
| GeneTree | ENSGT00600000084290. |
| HOVERGEN | HBG005639. |
| InParanoid | Q92636. |
| OrthoDB | EOG4M91QQ. |
| PhylomeDB | Q92636. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | tnfpathway. TNF receptor signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q92636. |
| Bgee | Q92636. |
| CleanEx | HS_NSMAF. |
| Genevestigator | Q92636. |
| GermOnline | ENSG00000035681. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000409. BEACH_dom. IPR004182. GRAM. IPR023362. PH-BEACH_dom. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR017986. WD40_repeat_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.1540.10. Beige_BEACH. 1 hit. G3DSA:2.30.29.40. G3DSA:2.30.29.40. 1 hit. G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF02138. Beach. 1 hit. PF02893. GRAM. 1 hit. PF00400. WD40. 5 hits. [Graphical view] |
| SMART | SM01026. Beach. 1 hit. SM00568. GRAM. 1 hit. SM00320. WD40. 7 hits. [Graphical view] |
| SUPFAM | SSF81837. Beige_BEACH. 1 hit. SSF50978. WD40_like. 1 hit. |
| PROSITE | PS50197. BEACH. 1 hit. PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 4 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | FAN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92636 Secondary accession number(s): B4DFB0, E9PCH0, Q8IW26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with