Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92619

- HMHA1_HUMAN

UniProt

Q92619 - HMHA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Minor histocompatibility protein HA-1

Gene

HMHA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases.Curated
Precursor of the histocompatibility antigen HA-1. More generally, minor histocompatibility antigens (mHags) refer to immunogenic peptide which, when complexed with MHC, can generate an immune response after recognition by specific T-cells. The peptides are derived from polymorphic intracellular proteins, which are cleaved by normal pathways of antigen processing. The binding of these peptides to MHC class I or class II molecules and its expression on the cell surface can stimulate T-cell responses and thereby trigger graft rejection or graft-versus-host disease (GVHD) after hematopoietic stem cell transplantation from HLA-identical sibling donor. GVHD is a frequent complication after bone marrow transplantation (BMT), due to mismatch of minor histocompatibility antigen in HLA-matched sibling marrow transplants. Specifically, mismatching for mHag HA-1 which is recognized as immunodominant, is shown to be associated with the development of severe GVHD after HLA-identical BMT. HA-1 is presented to the cell surface by MHC class I HLA-A*0201, but also by other HLA-A alleles. This complex specifically elicits donor-cytotoxic T-lymphocyte (CTL) reactivity against hematologic malignancies after treatment by HLA-identical allogenic BMT. It induces cell recognition and lysis by CTL.4 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri702 – 74746Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Minor histocompatibility protein HA-1
Cleaved into the following chain:
Gene namesi
Name:HMHA1
Synonyms:KIAA0223
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:17102. HMHA1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. membrane Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394633.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11361136Minor histocompatibility protein HA-1PRO_0000330312Add
BLAST
Peptidei137 – 1459Minor histocompatibility antigen HA-1PRO_0000330313

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei23 – 231Phosphoserine2 Publications
Modified residuei25 – 251Phosphoserine1 Publication
Modified residuei73 – 731Phosphoserine1 Publication
Modified residuei93 – 931Phosphoserine1 Publication
Modified residuei99 – 991Phosphoserine2 Publications
Modified residuei569 – 5691Phosphoserine2 Publications
Modified residuei578 – 5781PhosphoserineBy similarity
Modified residuei619 – 6191Phosphoserine1 Publication
Modified residuei1027 – 10271PhosphoserineBy similarity
Modified residuei1030 – 10301PhosphoserineBy similarity
Modified residuei1032 – 10321PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ92619.
PaxDbiQ92619.
PRIDEiQ92619.

PTM databases

PhosphoSiteiQ92619.

Expressioni

Tissue specificityi

Expressed on cells of the hematopoietic lineage. Detected in dendritic cells and epidermal Langerhans cells. Expressed in peripheral blood mononuclear cells, in all leukemia/lymphoma cell lines. Detected also in some solid tumors and tissues such as cancerous and non-cancerous tissue.2 Publications

Gene expression databases

BgeeiQ92619.
ExpressionAtlasiQ92619. baseline and differential.
GenevestigatoriQ92619.

Organism-specific databases

HPAiHPA019816.

Interactioni

Subunit structurei

HA-1 forms a complex with MHC class I HLA-A*0201.

Protein-protein interaction databases

BioGridi117072. 4 interactions.
IntActiQ92619. 2 interactions.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3D25X-ray1.30C140-145[»]
3FT3X-ray1.95P137-145[»]
ProteinModelPortaliQ92619.
SMRiQ92619. Positions 268-547, 696-974.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92619.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini761 – 974214Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili376 – 41237Sequence AnalysisAdd
BLAST
Coiled coili440 – 49960Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri702 – 74746Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiNOG310169.
GeneTreeiENSGT00760000119098.
HOVERGENiHBG107979.
InParanoidiQ92619.
OrthoDBiEOG7QNVK4.
PhylomeDBiQ92619.
TreeFamiTF351450.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR001060. FCH_dom.
IPR002219. PE/DAG-bd.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92619-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSRKKRELM KTPSISKKNR AGSPSPQPSG ELPRKDGADA VFPGPSLEPP
60 70 80 90 100
AGSSGVKATG TLKRPTSLSR HASAAGFPLS GAASWTLGRS HRSPLTAASP
110 120 130 140 150
GELPTEGAGP DVVEDISHLL ADVARFAEGL EKLKECVLRD DLLEARRPRA
160 170 180 190 200
HECLGEALRV MHQIISKYPL LNTVETLTAA GTLIAKVKAF HYESNNDLEK
210 220 230 240 250
QEFEKALETI AVAFSSTVSE FLMGEVDSST LLAVPPGDSS QSMESLYGPG
260 270 280 290 300
SEGTPPSLED CDAGCLPAEE VDVLLQRCEG GVDAALLYAK NMAKYMKDLI
310 320 330 340 350
SYLEKRTTLE MEFAKGLQKI AHNCRQSVMQ EPHMPLLSIY SLALEQDLEF
360 370 380 390 400
GHSMVQAVGT LQTQTFMQPL TLRRLEHEKR RKEIKEAWHR AQRKLQEAES
410 420 430 440 450
NLRKAKQGYV QRCEDHDKAR FLVAKAEEEQ AGSAPGAGST ATKTLDKRRR
460 470 480 490 500
LEEEAKNKAE EAMATYRTCV ADAKTQKQEL EDTKVTALRQ IQEVIRQSDQ
510 520 530 540 550
TIKSATISYY QMMHMQTAPL PVHFQMLCES SKLYDPGQQY ASHVRQLQRD
560 570 580 590 600
QEPDVHYDFE PHVSANAWSP VMRARKSSFN VSDVARPEAA GSPPEEGGCT
610 620 630 640 650
EGTPAKDHRA GRGHQVHKSW PLSISDSDSG LDPGPGAGDF KKFERTSSSG
660 670 680 690 700
TMSSTEELVD PDGGAGASAF EQADLNGMTP ELPVAVPSGP FRHEGLSKAA
710 720 730 740 750
RTHRLRKLRT PAKCRECNSY VYFQGAECEE CCLACHKKCL ETLAIQCGHK
760 770 780 790 800
KLQGRLQLFG QDFSHAARSA PDGVPFIVKK CVCEIERRAL RTKGIYRVNG
810 820 830 840 850
VKTRVEKLCQ AFENGKELVE LSQASPHDIS NVLKLYLRQL PEPLISFRLY
860 870 880 890 900
HELVGLAKDS LKAEAEAKAA SRGRQDGSES EAVAVALAGR LRELLRDLPP
910 920 930 940 950
ENRASLQYLL RHLRRIVEVE QDNKMTPGNL GIVFGPTLLR PRPTEATVSL
960 970 980 990 1000
SSLVDYPHQA RVIETLIVHY GLVFEEEPEE TPGGQDESSN QRAEVVVQVP
1010 1020 1030 1040 1050
YLEAGEAVVY PLQEAAADGC RESRVVSNDS DSDLEEASEL LSSSEASALG
1060 1070 1080 1090 1100
HLSFLEQQQS EASLEVASGS HSGSEEQLEA TAREDGDGDE DGPAQQLSGF
1110 1120 1130
NTNQSNNVLQ APLPPMRLRG GRMTLGSCRE RQPEFV
Length:1,136
Mass (Da):124,614
Last modified:April 29, 2008 - v2
Checksum:i9536787B3B1EE16D
GO
Isoform 2 (identifier: Q92619-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MFSRKKRELMKTPSISKKNRAGSPSPQPSG → MSRGQRVLKG...CPRDLPLPPE

Note: No experimental confirmation available.

Show »
Length:1,152
Mass (Da):126,497
Checksum:iE3144EE985E43A96
GO

Sequence cautioni

The sequence BAA13212.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti648 – 6481S → F in BAG62086. (PubMed:14702039)Curated

Polymorphismi

The HA-1H allele is presented on the cell surface and recognized by CTL, whereas the HA-1R allele is poorly represented by HLA-A and non-immunogenic, although HA-1R allelic frequency is the highest.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti139 – 1391R → H in allele HA-1H; induction of CTL recognition for epitope HA-1. 6 Publications
Corresponds to variant rs1801284 [ dbSNP | Ensembl ].
VAR_042693
Natural varianti259 – 2591E → D.1 Publication
Corresponds to variant rs2074442 [ dbSNP | Ensembl ].
VAR_042694
Natural varianti439 – 4391S → G.1 Publication
Corresponds to variant rs7251797 [ dbSNP | Ensembl ].
VAR_042695
Natural varianti515 – 5151M → I.
Corresponds to variant rs36084354 [ dbSNP | Ensembl ].
VAR_042696
Natural varianti886 – 8861A → P.
Corresponds to variant rs34569196 [ dbSNP | Ensembl ].
VAR_042697

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MFSRK…PQPSG → MSRGQRVLKGLLGWVCTWTW AWRARLGARGCGLHVLCPRD LPLPPE in isoform 2. 1 PublicationVSP_044707Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308066
, AF308045, AF308046, AF308047, AF308048, AF308049, AF308050, AF308051, AF308052, AF308053, AF308054, AF308055, AF308056, AF308057, AF308058, AF308059, AF308060, AF308061, AF308062, AF308063, AF308064, AF308065, AF311102 Genomic DNA. Translation: AAN04658.1.
D86976 mRNA. Translation: BAA13212.1. Different initiation.
AK300341 mRNA. Translation: BAG62086.1.
AC004151 Genomic DNA. Translation: AAC03237.1.
AC011558 Genomic DNA. No translation available.
AC093066 Genomic DNA. No translation available.
CH471139 Genomic DNA. Translation: EAW69551.1.
BC048129 mRNA. Translation: AAH48129.1.
BC065223 mRNA. Translation: AAH65223.1.
AF207595 Genomic DNA. Translation: AAG02014.1.
AF207596 Genomic DNA. Translation: AAG02015.1.
AF207597 Genomic DNA. Translation: AAG02016.1.
AF236756 Genomic DNA. Translation: AAF91292.1.
CCDSiCCDS32863.1. [Q92619-1]
CCDS58637.1. [Q92619-2]
PIRiD59433.
RefSeqiNP_001245257.1. NM_001258328.2. [Q92619-2]
NP_001269263.1. NM_001282334.1.
NP_001269264.1. NM_001282335.1.
NP_036424.2. NM_012292.4. [Q92619-1]
UniGeneiHs.465521.
Hs.710732.

Genome annotation databases

EnsembliENST00000313093; ENSP00000316772; ENSG00000180448. [Q92619-1]
ENST00000539243; ENSP00000439601; ENSG00000180448. [Q92619-2]
GeneIDi23526.
KEGGihsa:23526.
UCSCiuc002lqz.2. human. [Q92619-1]

Polymorphism databases

DMDMi187471158.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308066
, AF308045 , AF308046 , AF308047 , AF308048 , AF308049 , AF308050 , AF308051 , AF308052 , AF308053 , AF308054 , AF308055 , AF308056 , AF308057 , AF308058 , AF308059 , AF308060 , AF308061 , AF308062 , AF308063 , AF308064 , AF308065 , AF311102 Genomic DNA. Translation: AAN04658.1 .
D86976 mRNA. Translation: BAA13212.1 . Different initiation.
AK300341 mRNA. Translation: BAG62086.1 .
AC004151 Genomic DNA. Translation: AAC03237.1 .
AC011558 Genomic DNA. No translation available.
AC093066 Genomic DNA. No translation available.
CH471139 Genomic DNA. Translation: EAW69551.1 .
BC048129 mRNA. Translation: AAH48129.1 .
BC065223 mRNA. Translation: AAH65223.1 .
AF207595 Genomic DNA. Translation: AAG02014.1 .
AF207596 Genomic DNA. Translation: AAG02015.1 .
AF207597 Genomic DNA. Translation: AAG02016.1 .
AF236756 Genomic DNA. Translation: AAF91292.1 .
CCDSi CCDS32863.1. [Q92619-1 ]
CCDS58637.1. [Q92619-2 ]
PIRi D59433.
RefSeqi NP_001245257.1. NM_001258328.2. [Q92619-2 ]
NP_001269263.1. NM_001282334.1.
NP_001269264.1. NM_001282335.1.
NP_036424.2. NM_012292.4. [Q92619-1 ]
UniGenei Hs.465521.
Hs.710732.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3D25 X-ray 1.30 C 140-145 [» ]
3FT3 X-ray 1.95 P 137-145 [» ]
ProteinModelPortali Q92619.
SMRi Q92619. Positions 268-547, 696-974.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117072. 4 interactions.
IntActi Q92619. 2 interactions.

PTM databases

PhosphoSitei Q92619.

Polymorphism databases

DMDMi 187471158.

Proteomic databases

MaxQBi Q92619.
PaxDbi Q92619.
PRIDEi Q92619.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313093 ; ENSP00000316772 ; ENSG00000180448 . [Q92619-1 ]
ENST00000539243 ; ENSP00000439601 ; ENSG00000180448 . [Q92619-2 ]
GeneIDi 23526.
KEGGi hsa:23526.
UCSCi uc002lqz.2. human. [Q92619-1 ]

Organism-specific databases

CTDi 23526.
GeneCardsi GC19P001066.
H-InvDB HIX0014570.
HGNCi HGNC:17102. HMHA1.
HPAi HPA019816.
MIMi 601155. gene.
neXtProti NX_Q92619.
PharmGKBi PA128394633.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310169.
GeneTreei ENSGT00760000119098.
HOVERGENi HBG107979.
InParanoidi Q92619.
OrthoDBi EOG7QNVK4.
PhylomeDBi Q92619.
TreeFami TF351450.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSi HMHA1. human.
EvolutionaryTracei Q92619.
GeneWikii HMHA1.
GenomeRNAii 23526.
NextBioi 45988.
PROi Q92619.
SOURCEi Search...

Gene expression databases

Bgeei Q92619.
ExpressionAtlasi Q92619. baseline and differential.
Genevestigatori Q92619.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
InterProi IPR001060. FCH_dom.
IPR002219. PE/DAG-bd.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view ]
Pfami PF00620. RhoGAP. 1 hit.
[Graphical view ]
SMARTi SM00109. C1. 1 hit.
SM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
PROSITEi PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene."
    Kaminski W.E., Piehler A., Schmitz G.
    Biochem. Biophys. Res. Commun. 278:782-789(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  4. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS HIS-139; ASP-259 AND GLY-439.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and Testis.
  7. "Genomic typing of minor histocompatibility antigen HA-1 by reference strand mediated conformation analysis (RSCA)."
    Arostegui J.I., Gallardo D., Rodriguez-Luaces M., Querol S., Madrigal J.A., Garcia-Lopez J., Granena A.
    Tissue Antigens 56:69-76(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139.
  8. "Sequence diversity within the HA-1 gene as detected by melting temperature assay without oligonucleotide probes."
    Graziano C., Giorgi M., Malentacchi C., Mattiuz P.L., Porfirio B.
    BMC Med. Genet. 6:36-36(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139.
  9. "The minor histocompatibility antigen HA-1: a diallelic gene with a single amino acid polymorphism."
    den Haan J.M., Meadows L.M., Wang W., Pool J., Blokland E., Bishop T.L., Reinhardus C., Shabanowitz J., Offringa R., Hunt D.F., Engelhard V.H., Goulmy E.
    Science 279:1054-1057(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 137-145, IDENTIFICATION BY MASS SPECTROMETRY, VARIANT HIS-139.
  10. "Minor histocompatibility antigens HA-1-, -2-, and -4-, and HY-specific cytotoxic T-cell clones inhibit human hematopoietic progenitor cell growth by a mechanism that is dependent on direct cell-cell contact."
    Marijt W.A.F., Veenhof W.F.J., Goulmy E., Willemze R., van Rood J.J., Falkenburg J.H.F.
    Blood 82:3778-3785(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Mismatches of minor histocompatibility antigens between HLA-identical donors and recipients and the development of graft-versus-host disease after bone marrow transplantation."
    Goulmy E., Schipper R., Pool J., Blokland E., Falkenburg J.H., Vossen J., Gratwohl A., Vogelsang G.B., van Houwelingen H.C., van Rood J.J.
    N. Engl. J. Med. 334:281-285(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  12. "Functional expression of minor histocompatibility antigens on human peripheral blood dendritic cells and epidermal Langerhans cells."
    van Lochem E., van der Keur M., Mommaas A.M., de Gast G.C., Goulmy E.
    Transpl. Immunol. 4:151-157(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  13. "HA-1 and the SMCY-derived peptide FIDSYICQV (H-Y) are immunodominant minor histocompatibility antigens after bone marrow transplantation."
    Rufer N., Wolpert E., Helg C., Tiercy J.-M., Gratwohl A., Chapuis B., Jeannet M., Goulmy E., Roosnek E.
    Transplantation 66:910-916(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  14. Cited for: TISSUE SPECIFICITY.
  15. "Hematopoiesis-restricted minor histocompatibility antigens HA-1- or HA-2-specific T cells can induce complete remissions of relapsed leukemia."
    Marijt W.A.E., Heemskerk M.H.M., Kloosterboer F.M., Goulmy E., Kester M.G.D., van der Hoorn M.A.W.G., van Luxemburg-Heys S.A.P., Hoogeboom M., Mutis T., Drijfhout J.W., van Rood J.J., Willemze R., Falkenburg J.H.F.
    Proc. Natl. Acad. Sci. U.S.A. 100:2742-2747(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  16. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23 AND SER-25, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
    Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
    J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99 AND SER-569, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: T-cell.
  19. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-73; SER-93; SER-99; SER-569 AND SER-619, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  20. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "Definition of the gene encoding the minor histocompatibility antigen HA-1 and typing for HA-1 from genomic DNA."
    Tseng L.-H., Lin M.-T., Martin P.J., Pei J., Smith A.G., Hansen J.A.
    Tissue Antigens 52:305-311(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT HIS-139.
  22. "Therapeutic and diagnostic applications of minor histocompatibility antigen HA-1 and HA-2 disparities in allogeneic hematopoietic stem cell transplantation: a survey of different populations."
    Di Terlizzi S., Zino E., Mazzi B., Magnani C., Tresoldi C., Perna S.K., Bregni M., Rossini S., Ciceri F., Bordignon C., Bonini C., Fleischhauer K.
    Biol. Blood Marrow Transplant. 12:95-101(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT HIS-139.

Entry informationi

Entry nameiHMHA1_HUMAN
AccessioniPrimary (citable) accession number: Q92619
Secondary accession number(s): B4DTS4
, F6QP70, Q6P189, Q7LE26, Q86WS1, Q8HX84, Q9GJN9, Q9GJP0, Q9GJP1, Q9MY24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: October 29, 2014
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Infusion of lymphocyte from mHag HA-1-negative donors results in a durable remission in mHag HA-1-positive patients with leukemia or multiple myeloma.

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3