Q92619 (HMHA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Minor histocompatibility protein HA-1 Cleaved into the following chain:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1136 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | GTPase activator for the Rho-type GTPases Potential. Ref.10 Ref.11 Ref.13 Ref.15 Precursor of the histocompatibility antigen HA-1. More generally, minor histocompatibility antigens (mHags) refer to immunogenic peptide which, when complexed with MHC, can generate an immune response after recognition by specific T-cells. The peptides are derived from polymorphic intracellular proteins, which are cleaved by normal pathways of antigen processing. The binding of these peptides to MHC class I or class II molecules and its expression on the cell surface can stimulate T-cell responses and thereby trigger graft rejection or graft-versus-host disease (GVHD) after hematopoietic stem cell transplantation from HLA-identical sibling donor. GVHD is a frequent complication after bone marrow transplantation (BMT), due to mismatch of minor histocompatibility antigen in HLA-matched sibling marrow transplants. Specifically, mismatching for mHag HA-1 which is recognized as immunodominant, is shown to be associated with the development of severe GVHD after HLA-identical BMT. HA-1 is presented to the cell surface by MHC class I HLA-A*0201, but also by other HLA-A alleles. This complex specifically elicits donor-cytotoxic T-lymphocyte (CTL) reactivity against hematologic malignancies after treatment by HLA-identical allogenic BMT. It induces cell recognition and lysis by CTL. Ref.10 Ref.11 Ref.13 Ref.15 |
| Subunit structure | HA-1 forms a complex with MHC class I HLA-A*0201. |
| Tissue specificity | Expressed on cells of the hematopoietic lineage. Detected in dendritic cells and epidermal Langerhans cells. Expressed in peripheral blood mononuclear cells, in all leukemia/lymphoma cell lines. Detected also in some solid tumors and tissues such as cancerous and non-cancerous tissue. Ref.12 Ref.14 |
| Polymorphism | The HA-1H allele is presented on the cell surface and recognized by CTL, whereas the HA-1R allele is poorly represented by HLA-A and non-immunogenic, although HA-1R allelic frequency is the highest. |
| Miscellaneous | Infusion of lymphocyte from mHag HA-1-negative donors results in a durable remission in mHag HA-1-positive patients with leukemia or multiple myeloma. |
| Sequence similarities | Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 Rho-GAP domain. |
| Sequence caution | The sequence BAA13212.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | GTPase activation |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of GTPase activity Inferred from electronic annotation. Source: GOC regulation of small GTPase mediated signal transductionTraceable author statement. Source: Reactome small GTPase mediated signal transductionTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | GTPase activator activity Inferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92619-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92619-2) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MFSRKKRELMKTPSISKKNRAGSPSPQPSG → MSRGQRVLKG...CPRDLPLPPE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1136 | 1136 | Minor histocompatibility protein HA-1 | PRO_0000330312 | |||||
| Peptide | 137 – 145 | 9 | Minor histocompatibility antigen HA-1 Ref.9 | PRO_0000330313 | |||||
Regions | |||||||||
| Domain | 761 – 974 | 214 | Rho-GAP | ||||||
| Zinc finger | 702 – 747 | 46 | Phorbol-ester/DAG-type | ||||||
| Coiled coil | 376 – 412 | 37 | Potential | ||||||
| Coiled coil | 440 – 499 | 60 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 23 | 1 | Phosphoserine Ref.16 Ref.19 | ||||||
| Modified residue | 25 | 1 | Phosphoserine Ref.16 | ||||||
| Modified residue | 73 | 1 | Phosphoserine Ref.19 | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.19 | ||||||
| Modified residue | 99 | 1 | Phosphoserine Ref.18 Ref.19 | ||||||
| Modified residue | 569 | 1 | Phosphoserine Ref.18 Ref.19 | ||||||
| Modified residue | 578 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 619 | 1 | Phosphoserine Ref.19 | ||||||
| Modified residue | 1027 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1030 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1032 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | MFSRK…PQPSG → MSRGQRVLKGLLGWVCTWTW AWRARLGARGCGLHVLCPRD LPLPPE in isoform 2. | VSP_044707 | |||||
| Natural variant | 139 | 1 | R → H in allele HA-1H; induction of CTL recognition for epitope HA-1. Ref.5 Ref.7 Ref.8 Ref.9 Ref.21 Ref.22 Corresponds to variant rs1801284 [ dbSNP | Ensembl ]. | VAR_042693 | |||||
| Natural variant | 259 | 1 | E → D. Ref.5 Corresponds to variant rs2074442 [ dbSNP | Ensembl ]. | VAR_042694 | |||||
| Natural variant | 439 | 1 | S → G. Ref.5 Corresponds to variant rs7251797 [ dbSNP | Ensembl ]. | VAR_042695 | |||||
| Natural variant | 515 | 1 | M → I. Corresponds to variant rs36084354 [ dbSNP | Ensembl ]. | VAR_042696 | |||||
| Natural variant | 886 | 1 | A → P. Corresponds to variant rs34569196 [ dbSNP | Ensembl ]. | VAR_042697 | |||||
Experimental info | |||||||||
| Sequence conflict | 648 | 1 | S → F in BAG62086. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene." Kaminski W.E., Piehler A., Schmitz G. Biochem. Biophys. Res. Commun. 278:782-789(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [4] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS HIS-139; ASP-259 AND GLY-439. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Testis. |
| [7] | "Genomic typing of minor histocompatibility antigen HA-1 by reference strand mediated conformation analysis (RSCA)." Arostegui J.I., Gallardo D., Rodriguez-Luaces M., Querol S., Madrigal J.A., Garcia-Lopez J., Granena A. Tissue Antigens 56:69-76(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139. |
| [8] | "Sequence diversity within the HA-1 gene as detected by melting temperature assay without oligonucleotide probes." Graziano C., Giorgi M., Malentacchi C., Mattiuz P.L., Porfirio B. BMC Med. Genet. 6:36-36(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139. |
| [9] | "The minor histocompatibility antigen HA-1: a diallelic gene with a single amino acid polymorphism." den Haan J.M., Meadows L.M., Wang W., Pool J., Blokland E., Bishop T.L., Reinhardus C., Shabanowitz J., Offringa R., Hunt D.F., Engelhard V.H., Goulmy E. Science 279:1054-1057(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 137-145, MASS SPECTROMETRY, VARIANT HIS-139. |
| [10] | "Minor histocompatibility antigens HA-1-, -2-, and -4-, and HY-specific cytotoxic T-cell clones inhibit human hematopoietic progenitor cell growth by a mechanism that is dependent on direct cell-cell contact." Marijt W.A.F., Veenhof W.F.J., Goulmy E., Willemze R., van Rood J.J., Falkenburg J.H.F. Blood 82:3778-3785(1993) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Mismatches of minor histocompatibility antigens between HLA-identical donors and recipients and the development of graft-versus-host disease after bone marrow transplantation." Goulmy E., Schipper R., Pool J., Blokland E., Falkenburg J.H., Vossen J., Gratwohl A., Vogelsang G.B., van Houwelingen H.C., van Rood J.J. N. Engl. J. Med. 334:281-285(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "Functional expression of minor histocompatibility antigens on human peripheral blood dendritic cells and epidermal Langerhans cells." van Lochem E., van der Keur M., Mommaas A.M., de Gast G.C., Goulmy E. Transpl. Immunol. 4:151-157(1996) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [13] | "HA-1 and the SMCY-derived peptide FIDSYICQV (H-Y) are immunodominant minor histocompatibility antigens after bone marrow transplantation." Rufer N., Wolpert E., Helg C., Tiercy J.-M., Gratwohl A., Chapuis B., Jeannet M., Goulmy E., Roosnek E. Transplantation 66:910-916(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "Expression of minor histocompatibility antigen, HA-1, in solid tumor cells." Fujii N., Hiraki A., Ikeda K., Ohmura Y., Nozaki I., Shinagawa K., Ishimaru F., Kiura K., Shimizu N., Tanimoto M., Harada M. Transplantation 73:1137-1141(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [15] | "Hematopoiesis-restricted minor histocompatibility antigens HA-1- or HA-2-specific T cells can induce complete remissions of relapsed leukemia." Marijt W.A.E., Heemskerk M.H.M., Kloosterboer F.M., Goulmy E., Kester M.G.D., van der Hoorn M.A.W.G., van Luxemburg-Heys S.A.P., Hoogeboom M., Mutis T., Drijfhout J.W., van Rood J.J., Willemze R., Falkenburg J.H.F. Proc. Natl. Acad. Sci. U.S.A. 100:2742-2747(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [16] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23 AND SER-25, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [18] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99 AND SER-569, MASS SPECTROMETRY. Tissue: T-cell. |
| [19] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-73; SER-93; SER-99; SER-569 AND SER-619, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [20] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "Definition of the gene encoding the minor histocompatibility antigen HA-1 and typing for HA-1 from genomic DNA." Tseng L.-H., Lin M.-T., Martin P.J., Pei J., Smith A.G., Hansen J.A. Tissue Antigens 52:305-311(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HIS-139. |
| [22] | "Therapeutic and diagnostic applications of minor histocompatibility antigen HA-1 and HA-2 disparities in allogeneic hematopoietic stem cell transplantation: a survey of different populations." Di Terlizzi S., Zino E., Mazzi B., Magnani C., Tresoldi C., Perna S.K., Bregni M., Rossini S., Ciceri F., Bordignon C., Bonini C., Fleischhauer K. Biol. Blood Marrow Transplant. 12:95-101(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HIS-139. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF308066 AF311102 Genomic DNA. Translation: AAN04658.1.D86976 mRNA. Translation: BAA13212.1. Different initiation. AK300341 mRNA. Translation: BAG62086.1. AC004151 Genomic DNA. Translation: AAC03237.1. AC011558 Genomic DNA. No translation available. AC093066 Genomic DNA. No translation available. CH471139 Genomic DNA. Translation: EAW69551.1. BC048129 mRNA. Translation: AAH48129.1. BC065223 mRNA. Translation: AAH65223.1. AF207595 Genomic DNA. Translation: AAG02014.1. AF207596 Genomic DNA. Translation: AAG02015.1. AF207597 Genomic DNA. Translation: AAG02016.1. AF236756 Genomic DNA. Translation: AAF91292.1. | ||||||||||||
| IPI | IPI00022471. IPI00943093. | ||||||||||||
| PIR | D59433. | ||||||||||||
| RefSeq | NP_001245257.1. NM_001258328.1. NP_036424.2. NM_012292.3. | ||||||||||||
| UniGene | Hs.465521. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q92619. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q92619. 2 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q92619. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 187471158. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q92619. | ||||||||||||
| PRIDE | Q92619. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000313093; ENSP00000316772; ENSG00000180448. ENST00000539243; ENSP00000439601; ENSG00000180448. | ||||||||||||
| GeneID | 23526. | ||||||||||||
| KEGG | hsa:23526. | ||||||||||||
| UCSC | uc002lqz.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 23526. | ||||||||||||
| GeneCards | GC19P001066. | ||||||||||||
| H-InvDB | HIX0014570. | ||||||||||||
| HGNC | HGNC:17102. HMHA1. | ||||||||||||
| HPA | HPA019816. | ||||||||||||
| MIM | 601155. gene. | ||||||||||||
| neXtProt | NX_Q92619. | ||||||||||||
| PharmGKB | PA128394633. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG310169. | ||||||||||||
| HOVERGEN | HBG107979. | ||||||||||||
| InParanoid | Q92619. | ||||||||||||
| OMA | HECLGEA. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q92619. | ||||||||||||
| Bgee | Q92619. | ||||||||||||
| Genevestigator | Q92619. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.555.10. 1 hit. | ||||||||||||
| InterPro | IPR001060. FCH_dom. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. [Graphical view] | ||||||||||||
| Pfam | PF00620. RhoGAP. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00109. C1. 1 hit. SM00055. FCH. 1 hit. SM00324. RhoGAP. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF48350. Rho_GAP. 1 hit. | ||||||||||||
| PROSITE | PS50238. RHOGAP. 1 hit. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | HMHA1. human. | ||||||||||||
| EvolutionaryTrace | Q92619. | ||||||||||||
| GenomeRNAi | 23526. | ||||||||||||
| NextBio | 45988. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | HMHA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92619 Secondary accession number(s): B4DTS4 Q9MY24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
