Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q92619 (HMHA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Minor histocompatibility protein HA-1

Cleaved into the following chain:

  1. Minor histocompatibility antigen HA-1
    Short name=mHag HA-1
Gene names
Name:HMHA1
Synonyms:KIAA0223
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1136 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

GTPase activator for the Rho-type GTPases Potential. Ref.10 Ref.11 Ref.13 Ref.15

Precursor of the histocompatibility antigen HA-1. More generally, minor histocompatibility antigens (mHags) refer to immunogenic peptide which, when complexed with MHC, can generate an immune response after recognition by specific T-cells. The peptides are derived from polymorphic intracellular proteins, which are cleaved by normal pathways of antigen processing. The binding of these peptides to MHC class I or class II molecules and its expression on the cell surface can stimulate T-cell responses and thereby trigger graft rejection or graft-versus-host disease (GVHD) after hematopoietic stem cell transplantation from HLA-identical sibling donor. GVHD is a frequent complication after bone marrow transplantation (BMT), due to mismatch of minor histocompatibility antigen in HLA-matched sibling marrow transplants. Specifically, mismatching for mHag HA-1 which is recognized as immunodominant, is shown to be associated with the development of severe GVHD after HLA-identical BMT. HA-1 is presented to the cell surface by MHC class I HLA-A*0201, but also by other HLA-A alleles. This complex specifically elicits donor-cytotoxic T-lymphocyte (CTL) reactivity against hematologic malignancies after treatment by HLA-identical allogenic BMT. It induces cell recognition and lysis by CTL. Ref.10 Ref.11 Ref.13 Ref.15

Subunit structure

HA-1 forms a complex with MHC class I HLA-A*0201.

Tissue specificity

Expressed on cells of the hematopoietic lineage. Detected in dendritic cells and epidermal Langerhans cells. Expressed in peripheral blood mononuclear cells, in all leukemia/lymphoma cell lines. Detected also in some solid tumors and tissues such as cancerous and non-cancerous tissue. Ref.12 Ref.14

Polymorphism

The HA-1H allele is presented on the cell surface and recognized by CTL, whereas the HA-1R allele is poorly represented by HLA-A and non-immunogenic, although HA-1R allelic frequency is the highest.

Miscellaneous

Infusion of lymphocyte from mHag HA-1-negative donors results in a durable remission in mHag HA-1-positive patients with leukemia or multiple myeloma.

Sequence similarities

Contains 1 phorbol-ester/DAG-type zinc finger.

Contains 1 Rho-GAP domain.

Sequence caution

The sequence BAA13212.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q92619-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q92619-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MFSRKKRELMKTPSISKKNRAGSPSPQPSG → MSRGQRVLKG...CPRDLPLPPE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11361136Minor histocompatibility protein HA-1
PRO_0000330312
Peptide137 – 1459Minor histocompatibility antigen HA-1 Ref.9
PRO_0000330313

Regions

Domain761 – 974214Rho-GAP
Zinc finger702 – 74746Phorbol-ester/DAG-type
Coiled coil376 – 41237 Potential
Coiled coil440 – 49960 Potential

Amino acid modifications

Modified residue231Phosphoserine Ref.16 Ref.19
Modified residue251Phosphoserine Ref.16
Modified residue731Phosphoserine Ref.19
Modified residue931Phosphoserine Ref.19
Modified residue991Phosphoserine Ref.18 Ref.19
Modified residue5691Phosphoserine Ref.18 Ref.19
Modified residue5781Phosphoserine By similarity
Modified residue6191Phosphoserine Ref.19
Modified residue10271Phosphoserine By similarity
Modified residue10301Phosphoserine By similarity
Modified residue10321Phosphoserine By similarity

Natural variations

Alternative sequence1 – 3030MFSRK…PQPSG → MSRGQRVLKGLLGWVCTWTW AWRARLGARGCGLHVLCPRD LPLPPE in isoform 2.
VSP_044707
Natural variant1391R → H in allele HA-1H; induction of CTL recognition for epitope HA-1. Ref.5 Ref.7 Ref.8 Ref.9 Ref.21 Ref.22
Corresponds to variant rs1801284 [ dbSNP | Ensembl ].
VAR_042693
Natural variant2591E → D. Ref.5
Corresponds to variant rs2074442 [ dbSNP | Ensembl ].
VAR_042694
Natural variant4391S → G. Ref.5
Corresponds to variant rs7251797 [ dbSNP | Ensembl ].
VAR_042695
Natural variant5151M → I.
Corresponds to variant rs36084354 [ dbSNP | Ensembl ].
VAR_042696
Natural variant8861A → P.
Corresponds to variant rs34569196 [ dbSNP | Ensembl ].
VAR_042697

Experimental info

Sequence conflict6481S → F in BAG62086. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 29, 2008. Version 2.
Checksum: 9536787B3B1EE16D

FASTA1,136124,614
        10         20         30         40         50         60 
MFSRKKRELM KTPSISKKNR AGSPSPQPSG ELPRKDGADA VFPGPSLEPP AGSSGVKATG 

        70         80         90        100        110        120 
TLKRPTSLSR HASAAGFPLS GAASWTLGRS HRSPLTAASP GELPTEGAGP DVVEDISHLL 

       130        140        150        160        170        180 
ADVARFAEGL EKLKECVLRD DLLEARRPRA HECLGEALRV MHQIISKYPL LNTVETLTAA 

       190        200        210        220        230        240 
GTLIAKVKAF HYESNNDLEK QEFEKALETI AVAFSSTVSE FLMGEVDSST LLAVPPGDSS 

       250        260        270        280        290        300 
QSMESLYGPG SEGTPPSLED CDAGCLPAEE VDVLLQRCEG GVDAALLYAK NMAKYMKDLI 

       310        320        330        340        350        360 
SYLEKRTTLE MEFAKGLQKI AHNCRQSVMQ EPHMPLLSIY SLALEQDLEF GHSMVQAVGT 

       370        380        390        400        410        420 
LQTQTFMQPL TLRRLEHEKR RKEIKEAWHR AQRKLQEAES NLRKAKQGYV QRCEDHDKAR 

       430        440        450        460        470        480 
FLVAKAEEEQ AGSAPGAGST ATKTLDKRRR LEEEAKNKAE EAMATYRTCV ADAKTQKQEL 

       490        500        510        520        530        540 
EDTKVTALRQ IQEVIRQSDQ TIKSATISYY QMMHMQTAPL PVHFQMLCES SKLYDPGQQY 

       550        560        570        580        590        600 
ASHVRQLQRD QEPDVHYDFE PHVSANAWSP VMRARKSSFN VSDVARPEAA GSPPEEGGCT 

       610        620        630        640        650        660 
EGTPAKDHRA GRGHQVHKSW PLSISDSDSG LDPGPGAGDF KKFERTSSSG TMSSTEELVD 

       670        680        690        700        710        720 
PDGGAGASAF EQADLNGMTP ELPVAVPSGP FRHEGLSKAA RTHRLRKLRT PAKCRECNSY 

       730        740        750        760        770        780 
VYFQGAECEE CCLACHKKCL ETLAIQCGHK KLQGRLQLFG QDFSHAARSA PDGVPFIVKK 

       790        800        810        820        830        840 
CVCEIERRAL RTKGIYRVNG VKTRVEKLCQ AFENGKELVE LSQASPHDIS NVLKLYLRQL 

       850        860        870        880        890        900 
PEPLISFRLY HELVGLAKDS LKAEAEAKAA SRGRQDGSES EAVAVALAGR LRELLRDLPP 

       910        920        930        940        950        960 
ENRASLQYLL RHLRRIVEVE QDNKMTPGNL GIVFGPTLLR PRPTEATVSL SSLVDYPHQA 

       970        980        990       1000       1010       1020 
RVIETLIVHY GLVFEEEPEE TPGGQDESSN QRAEVVVQVP YLEAGEAVVY PLQEAAADGC 

      1030       1040       1050       1060       1070       1080 
RESRVVSNDS DSDLEEASEL LSSSEASALG HLSFLEQQQS EASLEVASGS HSGSEEQLEA 

      1090       1100       1110       1120       1130 
TAREDGDGDE DGPAQQLSGF NTNQSNNVLQ APLPPMRLRG GRMTLGSCRE RQPEFV 

« Hide

Isoform 2 [UniParc].

Checksum: E3144EE985E43A96
Show »

FASTA1,152126,497

References

« Hide 'large scale' references
[1]"Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene."
Kaminski W.E., Piehler A., Schmitz G.
Biochem. Biophys. Res. Commun. 278:782-789(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[2]"Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Bone marrow.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[4]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS HIS-139; ASP-259 AND GLY-439.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain and Testis.
[7]"Genomic typing of minor histocompatibility antigen HA-1 by reference strand mediated conformation analysis (RSCA)."
Arostegui J.I., Gallardo D., Rodriguez-Luaces M., Querol S., Madrigal J.A., Garcia-Lopez J., Granena A.
Tissue Antigens 56:69-76(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139.
[8]"Sequence diversity within the HA-1 gene as detected by melting temperature assay without oligonucleotide probes."
Graziano C., Giorgi M., Malentacchi C., Mattiuz P.L., Porfirio B.
BMC Med. Genet. 6:36-36(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 82-140, VARIANT HIS-139.
[9]"The minor histocompatibility antigen HA-1: a diallelic gene with a single amino acid polymorphism."
den Haan J.M., Meadows L.M., Wang W., Pool J., Blokland E., Bishop T.L., Reinhardus C., Shabanowitz J., Offringa R., Hunt D.F., Engelhard V.H., Goulmy E.
Science 279:1054-1057(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 137-145, IDENTIFICATION BY MASS SPECTROMETRY, VARIANT HIS-139.
[10]"Minor histocompatibility antigens HA-1-, -2-, and -4-, and HY-specific cytotoxic T-cell clones inhibit human hematopoietic progenitor cell growth by a mechanism that is dependent on direct cell-cell contact."
Marijt W.A.F., Veenhof W.F.J., Goulmy E., Willemze R., van Rood J.J., Falkenburg J.H.F.
Blood 82:3778-3785(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[11]"Mismatches of minor histocompatibility antigens between HLA-identical donors and recipients and the development of graft-versus-host disease after bone marrow transplantation."
Goulmy E., Schipper R., Pool J., Blokland E., Falkenburg J.H., Vossen J., Gratwohl A., Vogelsang G.B., van Houwelingen H.C., van Rood J.J.
N. Engl. J. Med. 334:281-285(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[12]"Functional expression of minor histocompatibility antigens on human peripheral blood dendritic cells and epidermal Langerhans cells."
van Lochem E., van der Keur M., Mommaas A.M., de Gast G.C., Goulmy E.
Transpl. Immunol. 4:151-157(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[13]"HA-1 and the SMCY-derived peptide FIDSYICQV (H-Y) are immunodominant minor histocompatibility antigens after bone marrow transplantation."
Rufer N., Wolpert E., Helg C., Tiercy J.-M., Gratwohl A., Chapuis B., Jeannet M., Goulmy E., Roosnek E.
Transplantation 66:910-916(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[14]"Expression of minor histocompatibility antigen, HA-1, in solid tumor cells."
Fujii N., Hiraki A., Ikeda K., Ohmura Y., Nozaki I., Shinagawa K., Ishimaru F., Kiura K., Shimizu N., Tanimoto M., Harada M.
Transplantation 73:1137-1141(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[15]"Hematopoiesis-restricted minor histocompatibility antigens HA-1- or HA-2-specific T cells can induce complete remissions of relapsed leukemia."
Marijt W.A.E., Heemskerk M.H.M., Kloosterboer F.M., Goulmy E., Kester M.G.D., van der Hoorn M.A.W.G., van Luxemburg-Heys S.A.P., Hoogeboom M., Mutis T., Drijfhout J.W., van Rood J.J., Willemze R., Falkenburg J.H.F.
Proc. Natl. Acad. Sci. U.S.A. 100:2742-2747(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[16]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23 AND SER-25, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[17]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[18]"Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99 AND SER-569, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: T-cell.
[19]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-73; SER-93; SER-99; SER-569 AND SER-619, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[20]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[21]"Definition of the gene encoding the minor histocompatibility antigen HA-1 and typing for HA-1 from genomic DNA."
Tseng L.-H., Lin M.-T., Martin P.J., Pei J., Smith A.G., Hansen J.A.
Tissue Antigens 52:305-311(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HIS-139.
[22]"Therapeutic and diagnostic applications of minor histocompatibility antigen HA-1 and HA-2 disparities in allogeneic hematopoietic stem cell transplantation: a survey of different populations."
Di Terlizzi S., Zino E., Mazzi B., Magnani C., Tresoldi C., Perna S.K., Bregni M., Rossini S., Ciceri F., Bordignon C., Bonini C., Fleischhauer K.
Biol. Blood Marrow Transplant. 12:95-101(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HIS-139.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF308066 expand/collapse EMBL AC list , AF308045, AF308046, AF308047, AF308048, AF308049, AF308050, AF308051, AF308052, AF308053, AF308054, AF308055, AF308056, AF308057, AF308058, AF308059, AF308060, AF308061, AF308062, AF308063, AF308064, AF308065, AF311102 Genomic DNA. Translation: AAN04658.1.
D86976 mRNA. Translation: BAA13212.1. Different initiation.
AK300341 mRNA. Translation: BAG62086.1.
AC004151 Genomic DNA. Translation: AAC03237.1.
AC011558 Genomic DNA. No translation available.
AC093066 Genomic DNA. No translation available.
CH471139 Genomic DNA. Translation: EAW69551.1.
BC048129 mRNA. Translation: AAH48129.1.
BC065223 mRNA. Translation: AAH65223.1.
AF207595 Genomic DNA. Translation: AAG02014.1.
AF207596 Genomic DNA. Translation: AAG02015.1.
AF207597 Genomic DNA. Translation: AAG02016.1.
AF236756 Genomic DNA. Translation: AAF91292.1.
PIRD59433.
RefSeqNP_001245257.1. NM_001258328.2.
NP_001269263.1. NM_001282334.1.
NP_001269264.1. NM_001282335.1.
NP_036424.2. NM_012292.4.
UniGeneHs.465521.
Hs.710732.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3D25X-ray1.30C137-145[»]
ProteinModelPortalQ92619.
SMRQ92619. Positions 268-547, 696-974.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117072. 3 interactions.
IntActQ92619. 2 interactions.

PTM databases

PhosphoSiteQ92619.

Polymorphism databases

DMDM187471158.

Proteomic databases

PaxDbQ92619.
PRIDEQ92619.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313093; ENSP00000316772; ENSG00000180448. [Q92619-1]
ENST00000539243; ENSP00000439601; ENSG00000180448. [Q92619-2]
GeneID23526.
KEGGhsa:23526.
UCSCuc002lqz.2. human. [Q92619-1]

Organism-specific databases

CTD23526.
GeneCardsGC19P001066.
H-InvDBHIX0014570.
HGNCHGNC:17102. HMHA1.
HPAHPA019816.
MIM601155. gene.
neXtProtNX_Q92619.
PharmGKBPA128394633.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG310169.
HOVERGENHBG107979.
InParanoidQ92619.
OrthoDBEOG7QNVK4.
PhylomeDBQ92619.
TreeFamTF351450.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressQ92619.
BgeeQ92619.
GenevestigatorQ92619.

Family and domain databases

Gene3D1.10.555.10. 1 hit.
InterProIPR001060. FCH_dom.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTSM00109. C1. 1 hit.
SM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMSSF48350. SSF48350. 1 hit.
PROSITEPS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSHMHA1. human.
EvolutionaryTraceQ92619.
GeneWikiHMHA1.
GenomeRNAi23526.
NextBio45988.
PROQ92619.
SOURCESearch...

Entry information

Entry nameHMHA1_HUMAN
AccessionPrimary (citable) accession number: Q92619
Secondary accession number(s): B4DTS4 expand/collapse secondary AC list , F6QP70, Q6P189, Q7LE26, Q86WS1, Q8HX84, Q9GJN9, Q9GJP0, Q9GJP1, Q9MY24
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: April 16, 2014
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM