Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex-interacting protein family member B3

Gene

NPIPB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-30711-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex-interacting protein family member B3
Alternative name(s):
Nuclear pore complex-interacting protein-like 3
Protein pps22-1
Gene namesi
Name:NPIPB3
Synonyms:KIAA0220, NPIPL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28989. NPIPB3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei63 – 87HelicalSequence analysisAdd BLAST25

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000169246.
ENSG00000243716.
PharmGKBiPA164724182.

Polymorphism and mutation databases

BioMutaiNPIPB3.
DMDMi215274263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000507351 – 1050Nuclear pore complex-interacting protein family member B3Add BLAST1050

Proteomic databases

PeptideAtlasiQ92617.
PRIDEiQ92617.

PTM databases

iPTMnetiQ92617.
PhosphoSitePlusiQ92617.

Expressioni

Gene expression databases

BgeeiENSG00000169246.
ExpressionAtlasiQ92617. baseline and differential.
GenevisibleiQ92617. HS.

Organism-specific databases

HPAiHPA053611.

Interactioni

Protein-protein interaction databases

BioGridi116739. 1 interactor.
IntActiQ92617. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ92617.
SMRiQ92617.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi247 – 1044Pro-richAdd BLAST798

Sequence similaritiesi

Belongs to the NPIP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00540000072033.
HOVERGENiHBG052821.
InParanoidiQ92617.
OMAiKDDATTH.
OrthoDBiEOG091G0FRG.
PhylomeDBiQ92617.

Family and domain databases

InterProiIPR009443. NPIP.
[Graphical view]
PANTHERiPTHR15438. PTHR15438. 2 hits.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92617-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKLSIVLTP QFLSHDQGQL TKELQQHVKS VTCPCEYLRK VINTLADHHH
60 70 80 90 100
RGTDFGGSPW LHVIIAFPTS YKVVITLWIV YLWVSLLKTI FWSRNGHDGS
110 120 130 140 150
TDVQQRAWRS NRRRQEGLRS ICMHTKKRVS SFRGNKIGLK DVITLRRHVE
160 170 180 190 200
TKVRAKIRKR KVTTKINHHD KINGKRKTAR KQKMFQRAQE LRRRAEDYHK
210 220 230 240 250
CKIPPSARKA LCNWVRMAAA EHRHSSGLPY WPYLTAETLK NRMGHQPPPP
260 270 280 290 300
TQQHSITDNS LSLKTPPECL LTPLPPSADD NLKTPPECVL TPLPPSADDN
310 320 330 340 350
LKTPPECVLT PLPPSADDNL KTPPECLLTP LPPSADDNLK TPPECLLTPL
360 370 380 390 400
PPSALPSAPP SADDNLKTRA ECLLHPLPPS ADDNLKTPSE RQLTPLPPSA
410 420 430 440 450
PPSADDNIKT PAERLRGPLP PSADDNLKTP SERQLTPLPP SAPPSADDNI
460 470 480 490 500
KTPAERLRGP LPPSADDNLK TPSERQLTPL PPSAPPSADD NIKTPAERLR
510 520 530 540 550
GPLPPSADDN LKTPSERQLT ALPPSADDNI KTPAERLRGP LPPSADDNLK
560 570 580 590 600
TPSERQLTPL PPSAPPSADD NIKTPAFHPQ RMIISRHLPS VSSLPFHPQL
610 620 630 640 650
HPQQMIISRH LPSVCGGRFH PQQMIISRHL PSVSSLPFHP QLHPQQMIIS
660 670 680 690 700
RHLPSVCGGR FHPQRMIISR HLPSVSSLPF HPQLHPQQMI ISRHLPSVCG
710 720 730 740 750
GRFHPQQMII SRHLPSVSSL PFHPQLHPQQ MIISRHLPSV CGGRFHPQRM
760 770 780 790 800
IISRHLPSVS SLPFHPQLHP QQMIISRHLP SVCGERLRGP LPPSADDNLK
810 820 830 840 850
TPSERQLTPL PPSAPPSADD NIKTPAERLR GPLPPSADDN LKTPSERQLT
860 870 880 890 900
PLPPSAPPSA DDNIKTPAER LRGPLPPSAD DNLKTPSERQ LTPLPPSAPP
910 920 930 940 950
SADDNIKTPA ERLRGPLPPS ADDNLKTPPL ATQEAEAEKP RKPKRQRAAE
960 970 980 990 1000
MEPPPEPKRR RVGDVEPSRK PKRRRAADVE PSSPEPKRRR VGDVEPSRKP
1010 1020 1030 1040 1050
KRRRAADVEP SSPEPKRRRV GDVEPSRKPK RRRAADVEPS LPEPKRRRLS
Length:1,050
Mass (Da):116,847
Last modified:November 25, 2008 - v5
Checksum:i342657B7685C9167
GO
Isoform 2 (identifier: Q92617-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     515-886: Missing.

Note: No experimental confirmation available.
Show »
Length:678
Mass (Da):75,695
Checksum:iB2B36F44C4945E2E
GO
Isoform 3 (identifier: Q92617-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRK → MFCCLGYEWLSGGCKTWHSAW
     577-868: Missing.

Note: No experimental confirmation available.
Show »
Length:739
Mass (Da):82,041
Checksum:iACF7138A80BF3264
GO
Isoform 4 (identifier: Q92617-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.
     515-928: Missing.

Show »
Length:420
Mass (Da):45,809
Checksum:iE342C1BEDD566725
GO
Isoform 5 (identifier: Q92617-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-327: Missing.
     413-576: Missing.
     785-826: ERLRGPLPPS...SADDNIKTPA → GRFHPQRMII...ISRHLPSVCG

Note: No experimental confirmation available.
Show »
Length:848
Mass (Da):95,824
Checksum:iA4E0A4C64C87928D
GO
Isoform 6 (identifier: Q92617-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     947-974: Missing.

Note: No experimental confirmation available.
Show »
Length:1,022
Mass (Da):113,539
Checksum:iDC9A8F9964D0B7E4
GO

Sequence cautioni

The sequence BAA13210 differs from that shown. Reason: Frameshift at position 203.Curated
The sequence BAD92869 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti21T → S in AAH36263 (PubMed:15489334).Curated1
Sequence conflicti138G → V in AAH36263 (PubMed:15489334).Curated1
Sequence conflicti388P → L in AAH36263 (PubMed:15489334).Curated1
Sequence conflicti521A → P in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti526A → APPSA in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti584Missing in BAD92869 (Ref. 2) Curated1
Sequence conflicti610 – 612HLP → YLL in BAA13210 (PubMed:9039502).Curated3
Sequence conflicti617G → F in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti621 – 623PQQ → HQP in BAA13210 (PubMed:9039502).Curated3
Sequence conflicti622 – 623QQ → ER in BAD92869 (Ref. 2) Curated2
Sequence conflicti664Q → E in BAD92869 (Ref. 2) Curated1
Sequence conflicti675V → I in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti707Q → R in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti707Q → R in BAD92869 (Ref. 2) Curated1
Sequence conflicti766P → T in BAA13210 (PubMed:9039502).Curated1
Sequence conflicti825P → S in AAH73943 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0218321 – 216Missing in isoform 4. 1 PublicationAdd BLAST216
Alternative sequenceiVSP_0218331 – 40MVKLS…EYLRK → MFCCLGYEWLSGGCKTWHSA W in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_021834290 – 327Missing in isoform 5. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_021835413 – 576Missing in isoform 5. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_021836515 – 928Missing in isoform 4. 1 PublicationAdd BLAST414
Alternative sequenceiVSP_021837515 – 886Missing in isoform 2. 1 PublicationAdd BLAST372
Alternative sequenceiVSP_021838577 – 868Missing in isoform 3. 1 PublicationAdd BLAST292
Alternative sequenceiVSP_021839785 – 826ERLRG…IKTPA → GRFHPQRMIISRHLPSVSSL PFHPQLHPQQMIISRHLPSV CG in isoform 5. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_033367947 – 974Missing in isoform 6. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86974 mRNA. Translation: BAA13210.2. Sequence problems.
AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation.
AC008740 Genomic DNA. No translation available.
BC036263 mRNA. Translation: AAH36263.1.
BC061522 mRNA. Translation: AAH61522.1.
BC073943 mRNA. Translation: AAH73943.1.
BC094882 mRNA. Translation: AAH94882.1.
AY498718 mRNA. Translation: AAS48701.1.
RefSeqiNP_569731.2. NM_130464.2.
UniGeneiHs.611072.
Hs.632865.
Hs.656872.
Hs.720286.

Genome annotation databases

EnsembliENST00000542817; ENSP00000444096; ENSG00000169246. [Q92617-4]
GeneIDi23117.
KEGGihsa:23117.
UCSCiuc059rux.1. human. [Q92617-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86974 mRNA. Translation: BAA13210.2. Sequence problems.
AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation.
AC008740 Genomic DNA. No translation available.
BC036263 mRNA. Translation: AAH36263.1.
BC061522 mRNA. Translation: AAH61522.1.
BC073943 mRNA. Translation: AAH73943.1.
BC094882 mRNA. Translation: AAH94882.1.
AY498718 mRNA. Translation: AAS48701.1.
RefSeqiNP_569731.2. NM_130464.2.
UniGeneiHs.611072.
Hs.632865.
Hs.656872.
Hs.720286.

3D structure databases

ProteinModelPortaliQ92617.
SMRiQ92617.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116739. 1 interactor.
IntActiQ92617. 3 interactors.

PTM databases

iPTMnetiQ92617.
PhosphoSitePlusiQ92617.

Polymorphism and mutation databases

BioMutaiNPIPB3.
DMDMi215274263.

Proteomic databases

PeptideAtlasiQ92617.
PRIDEiQ92617.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000542817; ENSP00000444096; ENSG00000169246. [Q92617-4]
GeneIDi23117.
KEGGihsa:23117.
UCSCiuc059rux.1. human. [Q92617-1]

Organism-specific databases

CTDi23117.
GeneCardsiNPIPB3.
H-InvDBHIX0173283.
HGNCiHGNC:28989. NPIPB3.
HPAiHPA053611.
neXtProtiNX_Q92617.
OpenTargetsiENSG00000169246.
ENSG00000243716.
PharmGKBiPA164724182.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00540000072033.
HOVERGENiHBG052821.
InParanoidiQ92617.
OMAiKDDATTH.
OrthoDBiEOG091G0FRG.
PhylomeDBiQ92617.

Enzyme and pathway databases

BioCyciZFISH:G66-30711-MONOMER.

Miscellaneous databases

GenomeRNAii23117.
PROiQ92617.

Gene expression databases

BgeeiENSG00000169246.
ExpressionAtlasiQ92617. baseline and differential.
GenevisibleiQ92617. HS.

Family and domain databases

InterProiIPR009443. NPIP.
[Graphical view]
PANTHERiPTHR15438. PTHR15438. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiNPIB3_HUMAN
AccessioniPrimary (citable) accession number: Q92617
Secondary accession number(s): O43332
, Q504Q6, Q59F29, Q6GMR1, Q6P7T2, Q6PIE2, Q6RH21
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 115 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.