Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q92617 (NPIB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear pore complex-interacting protein family member B3
Alternative name(s):
Nuclear pore complex-interacting protein-like 3
Protein pps22-1
Gene names
Name:NPIPB3
Synonyms:KIAA0220, NPIPL3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1050 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Single-pass membrane protein Potential.

Sequence similarities

Belongs to the NPIP family.

Sequence caution

The sequence BAA13210.2 differs from that shown. Reason: Frameshift at position 203.

The sequence BAD92869.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q92617-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q92617-2)

The sequence of this isoform differs from the canonical sequence as follows:
     515-886: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q92617-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRK → MFCCLGYEWLSGGCKTWHSAW
     577-868: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q92617-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.
     515-928: Missing.
Isoform 5 (identifier: Q92617-5)

The sequence of this isoform differs from the canonical sequence as follows:
     290-327: Missing.
     413-576: Missing.
     785-826: ERLRGPLPPS...SADDNIKTPA → GRFHPQRMII...ISRHLPSVCG
Note: No experimental confirmation available.
Isoform 6 (identifier: Q92617-6)

The sequence of this isoform differs from the canonical sequence as follows:
     947-974: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10501050Nuclear pore complex-interacting protein family member B3
PRO_0000050735

Regions

Transmembrane63 – 8725Helical; Potential
Compositional bias247 – 1044798Pro-rich

Natural variations

Alternative sequence1 – 216216Missing in isoform 4.
VSP_021832
Alternative sequence1 – 4040MVKLS…EYLRK → MFCCLGYEWLSGGCKTWHSA W in isoform 3.
VSP_021833
Alternative sequence290 – 32738Missing in isoform 5.
VSP_021834
Alternative sequence413 – 576164Missing in isoform 5.
VSP_021835
Alternative sequence515 – 928414Missing in isoform 4.
VSP_021836
Alternative sequence515 – 886372Missing in isoform 2.
VSP_021837
Alternative sequence577 – 868292Missing in isoform 3.
VSP_021838
Alternative sequence785 – 82642ERLRG…IKTPA → GRFHPQRMIISRHLPSVSSL PFHPQLHPQQMIISRHLPSV CG in isoform 5.
VSP_021839
Alternative sequence947 – 97428Missing in isoform 6.
VSP_033367

Experimental info

Sequence conflict211T → S in AAH36263. Ref.4
Sequence conflict1381G → V in AAH36263. Ref.4
Sequence conflict3881P → L in AAH36263. Ref.4
Sequence conflict5211A → P in BAA13210. Ref.1
Sequence conflict5261A → APPSA in BAA13210. Ref.1
Sequence conflict5841Missing in BAD92869. Ref.2
Sequence conflict610 – 6123HLP → YLL in BAA13210. Ref.1
Sequence conflict6171G → F in BAA13210. Ref.1
Sequence conflict621 – 6233PQQ → HQP in BAA13210. Ref.1
Sequence conflict622 – 6232QQ → ER in BAD92869. Ref.2
Sequence conflict6641Q → E in BAD92869. Ref.2
Sequence conflict6751V → I in BAA13210. Ref.1
Sequence conflict7071Q → R in BAA13210. Ref.1
Sequence conflict7071Q → R in BAD92869. Ref.2
Sequence conflict7661P → T in BAA13210. Ref.1
Sequence conflict8251P → S in AAH73943. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 25, 2008. Version 5.
Checksum: 342657B7685C9167

FASTA1,050116,847
        10         20         30         40         50         60 
MVKLSIVLTP QFLSHDQGQL TKELQQHVKS VTCPCEYLRK VINTLADHHH RGTDFGGSPW 

        70         80         90        100        110        120 
LHVIIAFPTS YKVVITLWIV YLWVSLLKTI FWSRNGHDGS TDVQQRAWRS NRRRQEGLRS 

       130        140        150        160        170        180 
ICMHTKKRVS SFRGNKIGLK DVITLRRHVE TKVRAKIRKR KVTTKINHHD KINGKRKTAR 

       190        200        210        220        230        240 
KQKMFQRAQE LRRRAEDYHK CKIPPSARKA LCNWVRMAAA EHRHSSGLPY WPYLTAETLK 

       250        260        270        280        290        300 
NRMGHQPPPP TQQHSITDNS LSLKTPPECL LTPLPPSADD NLKTPPECVL TPLPPSADDN 

       310        320        330        340        350        360 
LKTPPECVLT PLPPSADDNL KTPPECLLTP LPPSADDNLK TPPECLLTPL PPSALPSAPP 

       370        380        390        400        410        420 
SADDNLKTRA ECLLHPLPPS ADDNLKTPSE RQLTPLPPSA PPSADDNIKT PAERLRGPLP 

       430        440        450        460        470        480 
PSADDNLKTP SERQLTPLPP SAPPSADDNI KTPAERLRGP LPPSADDNLK TPSERQLTPL 

       490        500        510        520        530        540 
PPSAPPSADD NIKTPAERLR GPLPPSADDN LKTPSERQLT ALPPSADDNI KTPAERLRGP 

       550        560        570        580        590        600 
LPPSADDNLK TPSERQLTPL PPSAPPSADD NIKTPAFHPQ RMIISRHLPS VSSLPFHPQL 

       610        620        630        640        650        660 
HPQQMIISRH LPSVCGGRFH PQQMIISRHL PSVSSLPFHP QLHPQQMIIS RHLPSVCGGR 

       670        680        690        700        710        720 
FHPQRMIISR HLPSVSSLPF HPQLHPQQMI ISRHLPSVCG GRFHPQQMII SRHLPSVSSL 

       730        740        750        760        770        780 
PFHPQLHPQQ MIISRHLPSV CGGRFHPQRM IISRHLPSVS SLPFHPQLHP QQMIISRHLP 

       790        800        810        820        830        840 
SVCGERLRGP LPPSADDNLK TPSERQLTPL PPSAPPSADD NIKTPAERLR GPLPPSADDN 

       850        860        870        880        890        900 
LKTPSERQLT PLPPSAPPSA DDNIKTPAER LRGPLPPSAD DNLKTPSERQ LTPLPPSAPP 

       910        920        930        940        950        960 
SADDNIKTPA ERLRGPLPPS ADDNLKTPPL ATQEAEAEKP RKPKRQRAAE MEPPPEPKRR 

       970        980        990       1000       1010       1020 
RVGDVEPSRK PKRRRAADVE PSSPEPKRRR VGDVEPSRKP KRRRAADVEP SSPEPKRRRV 

      1030       1040       1050 
GDVEPSRKPK RRRAADVEPS LPEPKRRRLS 

« Hide

Isoform 2 [UniParc].

Checksum: B2B36F44C4945E2E
Show »

FASTA67875,695
Isoform 3 [UniParc].

Checksum: ACF7138A80BF3264
Show »

FASTA73982,041
Isoform 4 [UniParc].

Checksum: E342C1BEDD566725
Show »

FASTA42045,809
Isoform 5 [UniParc].

Checksum: A4E0A4C64C87928D
Show »

FASTA84895,824
Isoform 6 [UniParc].

Checksum: DC9A8F9964D0B7E4
Show »

FASTA1,022113,539

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Bone marrow.
[2]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Spleen.
[3]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 690-1050 (ISOFORM 1).
Tissue: Lymph, Mammary carcinoma, Pancreas and PNS.
[5]"Cloning and identification of a new protein coding gene pps22-1 binding with promoter DNA of pre-pre-S gene of hepatitis B virus."
Huang Y.-P., Cheng J., Yang Y.-J.
Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 917-1050 (ISOFORM 6).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D86974 mRNA. Translation: BAA13210.2. Sequence problems.
AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation.
AC008740 Genomic DNA. No translation available.
BC036263 mRNA. Translation: AAH36263.1.
BC061522 mRNA. Translation: AAH61522.1.
BC073943 mRNA. Translation: AAH73943.1.
BC094882 mRNA. Translation: AAH94882.1.
AY498718 mRNA. Translation: AAS48701.1.
RefSeqNP_569731.2. NM_130464.2.
UniGeneHs.611072.
Hs.632865.
Hs.656872.
Hs.720286.

3D structure databases

ProteinModelPortalQ92617.
SMRQ92617. Positions 1-41.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ92617. 2 interactions.
STRING9606.ENSP00000399107.

PTM databases

PhosphoSiteQ92617.

Polymorphism databases

DMDM215274263.

Proteomic databases

PaxDbQ92617.
PRIDEQ92617.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000542817; ENSP00000444096; ENSG00000169246. [Q92617-4]
GeneID23117.
KEGGhsa:23117.
UCSCuc002djq.3. human. [Q92617-2]
uc021tem.1. human. [Q92617-3]

Organism-specific databases

CTD23117.
GeneCardsGC16M021414.
H-InvDBHIX0173283.
HGNCHGNC:28989. NPIPB3.
neXtProtNX_Q92617.
PharmGKBPA164724182.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOVERGENHBG052821.
PhylomeDBQ92617.

Gene expression databases

BgeeQ92617.
GenevestigatorQ92617.

Family and domain databases

InterProIPR009443. NPIP.
[Graphical view]
PANTHERPTHR15438. PTHR15438. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi23117.
NextBio44328.
PROQ92617.

Entry information

Entry nameNPIB3_HUMAN
AccessionPrimary (citable) accession number: Q92617
Secondary accession number(s): O43332 expand/collapse secondary AC list , Q504Q6, Q59F29, Q6GMR1, Q6P7T2, Q6PIE2, Q6RH21
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 25, 2008
Last modified: April 16, 2014
This is version 96 of the entry and version 5 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM