Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92617

- NPIB3_HUMAN

UniProt

Q92617 - NPIB3_HUMAN

Protein

Nuclear pore complex-interacting protein family member B3

Gene

NPIPB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 5 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear pore complex-interacting protein family member B3
    Alternative name(s):
    Nuclear pore complex-interacting protein-like 3
    Protein pps22-1
    Gene namesi
    Name:NPIPB3
    Synonyms:KIAA0220, NPIPL3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:28989. NPIPB3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164724182.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10501050Nuclear pore complex-interacting protein family member B3PRO_0000050735Add
    BLAST

    Proteomic databases

    PaxDbiQ92617.
    PRIDEiQ92617.

    PTM databases

    PhosphoSiteiQ92617.

    Expressioni

    Gene expression databases

    BgeeiQ92617.
    GenevestigatoriQ92617.

    Interactioni

    Protein-protein interaction databases

    IntActiQ92617. 2 interactions.
    STRINGi9606.ENSP00000399107.

    Structurei

    3D structure databases

    ProteinModelPortaliQ92617.
    SMRiQ92617. Positions 1-41.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei63 – 8725HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi247 – 1044798Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the NPIP family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG12793.
    HOVERGENiHBG052821.
    PhylomeDBiQ92617.

    Family and domain databases

    InterProiIPR009443. NPIP.
    [Graphical view]
    PANTHERiPTHR15438. PTHR15438. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q92617-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVKLSIVLTP QFLSHDQGQL TKELQQHVKS VTCPCEYLRK VINTLADHHH     50
    RGTDFGGSPW LHVIIAFPTS YKVVITLWIV YLWVSLLKTI FWSRNGHDGS 100
    TDVQQRAWRS NRRRQEGLRS ICMHTKKRVS SFRGNKIGLK DVITLRRHVE 150
    TKVRAKIRKR KVTTKINHHD KINGKRKTAR KQKMFQRAQE LRRRAEDYHK 200
    CKIPPSARKA LCNWVRMAAA EHRHSSGLPY WPYLTAETLK NRMGHQPPPP 250
    TQQHSITDNS LSLKTPPECL LTPLPPSADD NLKTPPECVL TPLPPSADDN 300
    LKTPPECVLT PLPPSADDNL KTPPECLLTP LPPSADDNLK TPPECLLTPL 350
    PPSALPSAPP SADDNLKTRA ECLLHPLPPS ADDNLKTPSE RQLTPLPPSA 400
    PPSADDNIKT PAERLRGPLP PSADDNLKTP SERQLTPLPP SAPPSADDNI 450
    KTPAERLRGP LPPSADDNLK TPSERQLTPL PPSAPPSADD NIKTPAERLR 500
    GPLPPSADDN LKTPSERQLT ALPPSADDNI KTPAERLRGP LPPSADDNLK 550
    TPSERQLTPL PPSAPPSADD NIKTPAFHPQ RMIISRHLPS VSSLPFHPQL 600
    HPQQMIISRH LPSVCGGRFH PQQMIISRHL PSVSSLPFHP QLHPQQMIIS 650
    RHLPSVCGGR FHPQRMIISR HLPSVSSLPF HPQLHPQQMI ISRHLPSVCG 700
    GRFHPQQMII SRHLPSVSSL PFHPQLHPQQ MIISRHLPSV CGGRFHPQRM 750
    IISRHLPSVS SLPFHPQLHP QQMIISRHLP SVCGERLRGP LPPSADDNLK 800
    TPSERQLTPL PPSAPPSADD NIKTPAERLR GPLPPSADDN LKTPSERQLT 850
    PLPPSAPPSA DDNIKTPAER LRGPLPPSAD DNLKTPSERQ LTPLPPSAPP 900
    SADDNIKTPA ERLRGPLPPS ADDNLKTPPL ATQEAEAEKP RKPKRQRAAE 950
    MEPPPEPKRR RVGDVEPSRK PKRRRAADVE PSSPEPKRRR VGDVEPSRKP 1000
    KRRRAADVEP SSPEPKRRRV GDVEPSRKPK RRRAADVEPS LPEPKRRRLS 1050
    Length:1,050
    Mass (Da):116,847
    Last modified:November 25, 2008 - v5
    Checksum:i342657B7685C9167
    GO
    Isoform 2 (identifier: Q92617-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         515-886: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:678
    Mass (Da):75,695
    Checksum:iB2B36F44C4945E2E
    GO
    Isoform 3 (identifier: Q92617-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-40: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRK → MFCCLGYEWLSGGCKTWHSAW
         577-868: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:739
    Mass (Da):82,041
    Checksum:iACF7138A80BF3264
    GO
    Isoform 4 (identifier: Q92617-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-216: Missing.
         515-928: Missing.

    Show »
    Length:420
    Mass (Da):45,809
    Checksum:iE342C1BEDD566725
    GO
    Isoform 5 (identifier: Q92617-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         290-327: Missing.
         413-576: Missing.
         785-826: ERLRGPLPPS...SADDNIKTPA → GRFHPQRMII...ISRHLPSVCG

    Note: No experimental confirmation available.

    Show »
    Length:848
    Mass (Da):95,824
    Checksum:iA4E0A4C64C87928D
    GO
    Isoform 6 (identifier: Q92617-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         947-974: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,022
    Mass (Da):113,539
    Checksum:iDC9A8F9964D0B7E4
    GO

    Sequence cautioni

    The sequence BAA13210.2 differs from that shown. Reason: Frameshift at position 203.
    The sequence BAD92869.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti21 – 211T → S in AAH36263. (PubMed:15489334)Curated
    Sequence conflicti138 – 1381G → V in AAH36263. (PubMed:15489334)Curated
    Sequence conflicti388 – 3881P → L in AAH36263. (PubMed:15489334)Curated
    Sequence conflicti521 – 5211A → P in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti526 – 5261A → APPSA in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti584 – 5841Missing in BAD92869. 1 PublicationCurated
    Sequence conflicti610 – 6123HLP → YLL in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti617 – 6171G → F in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti621 – 6233PQQ → HQP in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti622 – 6232QQ → ER in BAD92869. 1 PublicationCurated
    Sequence conflicti664 – 6641Q → E in BAD92869. 1 PublicationCurated
    Sequence conflicti675 – 6751V → I in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti707 – 7071Q → R in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti707 – 7071Q → R in BAD92869. 1 PublicationCurated
    Sequence conflicti766 – 7661P → T in BAA13210. (PubMed:9039502)Curated
    Sequence conflicti825 – 8251P → S in AAH73943. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 216216Missing in isoform 4. 1 PublicationVSP_021832Add
    BLAST
    Alternative sequencei1 – 4040MVKLS…EYLRK → MFCCLGYEWLSGGCKTWHSA W in isoform 3. 1 PublicationVSP_021833Add
    BLAST
    Alternative sequencei290 – 32738Missing in isoform 5. 1 PublicationVSP_021834Add
    BLAST
    Alternative sequencei413 – 576164Missing in isoform 5. 1 PublicationVSP_021835Add
    BLAST
    Alternative sequencei515 – 928414Missing in isoform 4. 1 PublicationVSP_021836Add
    BLAST
    Alternative sequencei515 – 886372Missing in isoform 2. 1 PublicationVSP_021837Add
    BLAST
    Alternative sequencei577 – 868292Missing in isoform 3. 1 PublicationVSP_021838Add
    BLAST
    Alternative sequencei785 – 82642ERLRG…IKTPA → GRFHPQRMIISRHLPSVSSL PFHPQLHPQQMIISRHLPSV CG in isoform 5. 1 PublicationVSP_021839Add
    BLAST
    Alternative sequencei947 – 97428Missing in isoform 6. 1 PublicationVSP_033367Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D86974 mRNA. Translation: BAA13210.2. Sequence problems.
    AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation.
    AC008740 Genomic DNA. No translation available.
    BC036263 mRNA. Translation: AAH36263.1.
    BC061522 mRNA. Translation: AAH61522.1.
    BC073943 mRNA. Translation: AAH73943.1.
    BC094882 mRNA. Translation: AAH94882.1.
    AY498718 mRNA. Translation: AAS48701.1.
    RefSeqiNP_569731.2. NM_130464.2.
    UniGeneiHs.611072.
    Hs.632865.
    Hs.656872.
    Hs.720286.

    Genome annotation databases

    EnsembliENST00000542817; ENSP00000444096; ENSG00000169246. [Q92617-4]
    GeneIDi23117.
    KEGGihsa:23117.
    UCSCiuc002djq.3. human. [Q92617-2]
    uc021tem.1. human. [Q92617-3]

    Polymorphism databases

    DMDMi215274263.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D86974 mRNA. Translation: BAA13210.2 . Sequence problems.
    AB209632 Transcribed RNA. Translation: BAD92869.1 . Different initiation.
    AC008740 Genomic DNA. No translation available.
    BC036263 mRNA. Translation: AAH36263.1 .
    BC061522 mRNA. Translation: AAH61522.1 .
    BC073943 mRNA. Translation: AAH73943.1 .
    BC094882 mRNA. Translation: AAH94882.1 .
    AY498718 mRNA. Translation: AAS48701.1 .
    RefSeqi NP_569731.2. NM_130464.2.
    UniGenei Hs.611072.
    Hs.632865.
    Hs.656872.
    Hs.720286.

    3D structure databases

    ProteinModelPortali Q92617.
    SMRi Q92617. Positions 1-41.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q92617. 2 interactions.
    STRINGi 9606.ENSP00000399107.

    PTM databases

    PhosphoSitei Q92617.

    Polymorphism databases

    DMDMi 215274263.

    Proteomic databases

    PaxDbi Q92617.
    PRIDEi Q92617.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000542817 ; ENSP00000444096 ; ENSG00000169246 . [Q92617-4 ]
    GeneIDi 23117.
    KEGGi hsa:23117.
    UCSCi uc002djq.3. human. [Q92617-2 ]
    uc021tem.1. human. [Q92617-3 ]

    Organism-specific databases

    CTDi 23117.
    GeneCardsi GC16M021414.
    H-InvDB HIX0173283.
    HGNCi HGNC:28989. NPIPB3.
    neXtProti NX_Q92617.
    PharmGKBi PA164724182.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOVERGENi HBG052821.
    PhylomeDBi Q92617.

    Miscellaneous databases

    GenomeRNAii 23117.
    NextBioi 44328.
    PROi Q92617.

    Gene expression databases

    Bgeei Q92617.
    Genevestigatori Q92617.

    Family and domain databases

    InterProi IPR009443. NPIP.
    [Graphical view ]
    PANTHERi PTHR15438. PTHR15438. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
      Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
      DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Bone marrow.
    2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Spleen.
    3. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 690-1050 (ISOFORM 1).
      Tissue: Lymph, Mammary carcinoma, Pancreas and PNS.
    5. "Cloning and identification of a new protein coding gene pps22-1 binding with promoter DNA of pre-pre-S gene of hepatitis B virus."
      Huang Y.-P., Cheng J., Yang Y.-J.
      Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 917-1050 (ISOFORM 6).

    Entry informationi

    Entry nameiNPIB3_HUMAN
    AccessioniPrimary (citable) accession number: Q92617
    Secondary accession number(s): O43332
    , Q504Q6, Q59F29, Q6GMR1, Q6P7T2, Q6PIE2, Q6RH21
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 97 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3