Q92617 (NPPL3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear pore complex-interacting protein-like 3 Alternative name(s): Protein pps22-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1050 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
| Sequence similarities | Belongs to the NPIP family. |
| Sequence caution | The sequence BAA13210.2 differs from that shown. Reason: Frameshift at position 203. The sequence BAD92869.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92617-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92617-2) The sequence of this isoform differs from the canonical sequence as follows: 515-886: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q92617-3) The sequence of this isoform differs from the canonical sequence as follows: 1-40: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRK → MFCCLGYEWLSGGCKTWHSAW 577-868: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q92617-4) The sequence of this isoform differs from the canonical sequence as follows: 1-216: Missing. 515-928: Missing. | ||||||
| Isoform 5 (identifier: Q92617-5) The sequence of this isoform differs from the canonical sequence as follows: 290-327: Missing. 413-576: Missing. 785-826: ERLRGPLPPS...SADDNIKTPA → GRFHPQRMII...ISRHLPSVCG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q92617-6) The sequence of this isoform differs from the canonical sequence as follows: 947-974: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1050 | 1050 | Nuclear pore complex-interacting protein-like 3 | PRO_0000050735 | |||||
Regions | |||||||||
| Transmembrane | 63 – 87 | 25 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 216 | 216 | Missing in isoform 4. | VSP_021832 | |||||
| Alternative sequence | 1 – 40 | 40 | MVKLS…EYLRK → MFCCLGYEWLSGGCKTWHSA W in isoform 3. | VSP_021833 | |||||
| Alternative sequence | 290 – 327 | 38 | Missing in isoform 5. | VSP_021834 | |||||
| Alternative sequence | 413 – 576 | 164 | Missing in isoform 5. | VSP_021835 | |||||
| Alternative sequence | 515 – 928 | 414 | Missing in isoform 4. | VSP_021836 | |||||
| Alternative sequence | 515 – 886 | 372 | Missing in isoform 2. | VSP_021837 | |||||
| Alternative sequence | 577 – 868 | 292 | Missing in isoform 3. | VSP_021838 | |||||
| Alternative sequence | 785 – 826 | 42 | ERLRG…IKTPA → GRFHPQRMIISRHLPSVSSL PFHPQLHPQQMIISRHLPSV CG in isoform 5. | VSP_021839 | |||||
| Alternative sequence | 947 – 974 | 28 | Missing in isoform 6. | VSP_033367 | |||||
Experimental info | |||||||||
| Sequence conflict | 21 | 1 | T → S in AAH36263. Ref.4 | ||||||
| Sequence conflict | 138 | 1 | G → V in AAH36263. Ref.4 | ||||||
| Sequence conflict | 388 | 1 | P → L in AAH36263. Ref.4 | ||||||
| Sequence conflict | 521 | 1 | A → P in BAA13210. Ref.1 | ||||||
| Sequence conflict | 526 | 1 | A → APPSA in BAA13210. Ref.1 | ||||||
| Sequence conflict | 584 | 1 | Missing in BAD92869. Ref.2 | ||||||
| Sequence conflict | 610 – 612 | 3 | HLP → YLL in BAA13210. Ref.1 | ||||||
| Sequence conflict | 617 | 1 | G → F in BAA13210. Ref.1 | ||||||
| Sequence conflict | 621 – 623 | 3 | PQQ → HQP in BAA13210. Ref.1 | ||||||
| Sequence conflict | 622 – 623 | 2 | QQ → ER in BAD92869. Ref.2 | ||||||
| Sequence conflict | 664 | 1 | Q → E in BAD92869. Ref.2 | ||||||
| Sequence conflict | 675 | 1 | V → I in BAA13210. Ref.1 | ||||||
| Sequence conflict | 707 | 1 | Q → R in BAA13210. Ref.1 | ||||||
| Sequence conflict | 707 | 1 | Q → R in BAD92869. Ref.2 | ||||||
| Sequence conflict | 766 | 1 | P → T in BAA13210. Ref.1 | ||||||
| Sequence conflict | 825 | 1 | P → S in AAH73943. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Spleen. |
| [3] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 690-1050 (ISOFORM 1). Tissue: Lymph, Mammary carcinoma, Pancreas and PNS. |
| [5] | "Cloning and identification of a new protein coding gene pps22-1 binding with promoter DNA of pre-pre-S gene of hepatitis B virus." Huang Y.-P., Cheng J., Yang Y.-J. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 917-1050 (ISOFORM 6). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D86974 mRNA. Translation: BAA13210.2. Sequence problems. AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation. AC008740 Genomic DNA. No translation available. BC036263 mRNA. Translation: AAH36263.1. BC061522 mRNA. Translation: AAH61522.1. BC073943 mRNA. Translation: AAH73943.1. BC094882 mRNA. Translation: AAH94882.1. AY498718 mRNA. Translation: AAS48701.1. |
| IPI | IPI00807454. IPI00807499. IPI00807535. IPI00807565. IPI00890704. IPI00956264. |
| RefSeq | NP_569731.2. NM_130464.2. |
| UniGene | Hs.611072. Hs.632865. Hs.656872. Hs.720286. |
3D structure databases | |
| ProteinModelPortal | Q92617. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q92617. 2 interactions. |
| STRING | 9606.ENSP00000399107. |
PTM databases | |
| PhosphoSite | Q92617. |
Polymorphism databases | |
| DMDM | 215274263. |
Proteomic databases | |
| PaxDb | Q92617. |
| PRIDE | Q92617. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000542817; ENSP00000444096; ENSG00000169246. |
| GeneID | 23117. |
| KEGG | hsa:23117. |
| UCSC | uc002djq.3. human. uc021tem.1. human. |
Organism-specific databases | |
| CTD | 23117. |
| GeneCards | GC16M021413. |
| H-InvDB | HIX0173283. |
| HGNC | HGNC:28989. NPIPL3. |
| neXtProt | NX_Q92617. |
| PharmGKB | PA164724182. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG12793. |
| HOVERGEN | HBG052821. |
Gene expression databases | |
| ArrayExpress | Q92617. |
| Bgee | Q92617. |
| Genevestigator | Q92617. |
| GermOnline | ENSG00000198064. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009443. NPIP. [Graphical view] |
| PANTHER | PTHR15438. PTHR15438. 1 hit. |
| Pfam | PF06409. NPIP. 12 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23117. |
| NextBio | 44328. |
Entry information
| Entry name | NPPL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92617 Secondary accession number(s): O43332 Q6RH21 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
