Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92617

- NPIB3_HUMAN

UniProt

Q92617 - NPIB3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear pore complex-interacting protein family member B3

Gene

NPIPB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex-interacting protein family member B3
Alternative name(s):
Nuclear pore complex-interacting protein-like 3
Protein pps22-1
Gene namesi
Name:NPIPB3
Synonyms:KIAA0220, NPIPL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:28989. NPIPB3.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164724182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10501050Nuclear pore complex-interacting protein family member B3PRO_0000050735Add
BLAST

Proteomic databases

PaxDbiQ92617.
PRIDEiQ92617.

PTM databases

PhosphoSiteiQ92617.

Expressioni

Gene expression databases

BgeeiQ92617.
ExpressionAtlasiQ92617. baseline.
GenevestigatoriQ92617.

Interactioni

Protein-protein interaction databases

IntActiQ92617. 2 interactions.
STRINGi9606.ENSP00000399107.

Structurei

3D structure databases

ProteinModelPortaliQ92617.
SMRiQ92617. Positions 1-41.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei63 – 8725HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi247 – 1044798Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the NPIP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00540000072033.
HOVERGENiHBG052821.
InParanoidiQ92617.
PhylomeDBiQ92617.

Family and domain databases

InterProiIPR009443. NPIP.
[Graphical view]
PANTHERiPTHR15438. PTHR15438. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92617-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKLSIVLTP QFLSHDQGQL TKELQQHVKS VTCPCEYLRK VINTLADHHH
60 70 80 90 100
RGTDFGGSPW LHVIIAFPTS YKVVITLWIV YLWVSLLKTI FWSRNGHDGS
110 120 130 140 150
TDVQQRAWRS NRRRQEGLRS ICMHTKKRVS SFRGNKIGLK DVITLRRHVE
160 170 180 190 200
TKVRAKIRKR KVTTKINHHD KINGKRKTAR KQKMFQRAQE LRRRAEDYHK
210 220 230 240 250
CKIPPSARKA LCNWVRMAAA EHRHSSGLPY WPYLTAETLK NRMGHQPPPP
260 270 280 290 300
TQQHSITDNS LSLKTPPECL LTPLPPSADD NLKTPPECVL TPLPPSADDN
310 320 330 340 350
LKTPPECVLT PLPPSADDNL KTPPECLLTP LPPSADDNLK TPPECLLTPL
360 370 380 390 400
PPSALPSAPP SADDNLKTRA ECLLHPLPPS ADDNLKTPSE RQLTPLPPSA
410 420 430 440 450
PPSADDNIKT PAERLRGPLP PSADDNLKTP SERQLTPLPP SAPPSADDNI
460 470 480 490 500
KTPAERLRGP LPPSADDNLK TPSERQLTPL PPSAPPSADD NIKTPAERLR
510 520 530 540 550
GPLPPSADDN LKTPSERQLT ALPPSADDNI KTPAERLRGP LPPSADDNLK
560 570 580 590 600
TPSERQLTPL PPSAPPSADD NIKTPAFHPQ RMIISRHLPS VSSLPFHPQL
610 620 630 640 650
HPQQMIISRH LPSVCGGRFH PQQMIISRHL PSVSSLPFHP QLHPQQMIIS
660 670 680 690 700
RHLPSVCGGR FHPQRMIISR HLPSVSSLPF HPQLHPQQMI ISRHLPSVCG
710 720 730 740 750
GRFHPQQMII SRHLPSVSSL PFHPQLHPQQ MIISRHLPSV CGGRFHPQRM
760 770 780 790 800
IISRHLPSVS SLPFHPQLHP QQMIISRHLP SVCGERLRGP LPPSADDNLK
810 820 830 840 850
TPSERQLTPL PPSAPPSADD NIKTPAERLR GPLPPSADDN LKTPSERQLT
860 870 880 890 900
PLPPSAPPSA DDNIKTPAER LRGPLPPSAD DNLKTPSERQ LTPLPPSAPP
910 920 930 940 950
SADDNIKTPA ERLRGPLPPS ADDNLKTPPL ATQEAEAEKP RKPKRQRAAE
960 970 980 990 1000
MEPPPEPKRR RVGDVEPSRK PKRRRAADVE PSSPEPKRRR VGDVEPSRKP
1010 1020 1030 1040 1050
KRRRAADVEP SSPEPKRRRV GDVEPSRKPK RRRAADVEPS LPEPKRRRLS
Length:1,050
Mass (Da):116,847
Last modified:November 25, 2008 - v5
Checksum:i342657B7685C9167
GO
Isoform 2 (identifier: Q92617-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     515-886: Missing.

Note: No experimental confirmation available.

Show »
Length:678
Mass (Da):75,695
Checksum:iB2B36F44C4945E2E
GO
Isoform 3 (identifier: Q92617-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRK → MFCCLGYEWLSGGCKTWHSAW
     577-868: Missing.

Note: No experimental confirmation available.

Show »
Length:739
Mass (Da):82,041
Checksum:iACF7138A80BF3264
GO
Isoform 4 (identifier: Q92617-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.
     515-928: Missing.

Show »
Length:420
Mass (Da):45,809
Checksum:iE342C1BEDD566725
GO
Isoform 5 (identifier: Q92617-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-327: Missing.
     413-576: Missing.
     785-826: ERLRGPLPPS...SADDNIKTPA → GRFHPQRMII...ISRHLPSVCG

Note: No experimental confirmation available.

Show »
Length:848
Mass (Da):95,824
Checksum:iA4E0A4C64C87928D
GO
Isoform 6 (identifier: Q92617-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     947-974: Missing.

Note: No experimental confirmation available.

Show »
Length:1,022
Mass (Da):113,539
Checksum:iDC9A8F9964D0B7E4
GO

Sequence cautioni

The sequence BAA13210.2 differs from that shown. Reason: Frameshift at position 203.
The sequence BAD92869.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti21 – 211T → S in AAH36263. (PubMed:15489334)Curated
Sequence conflicti138 – 1381G → V in AAH36263. (PubMed:15489334)Curated
Sequence conflicti388 – 3881P → L in AAH36263. (PubMed:15489334)Curated
Sequence conflicti521 – 5211A → P in BAA13210. (PubMed:9039502)Curated
Sequence conflicti526 – 5261A → APPSA in BAA13210. (PubMed:9039502)Curated
Sequence conflicti584 – 5841Missing in BAD92869. 1 PublicationCurated
Sequence conflicti610 – 6123HLP → YLL in BAA13210. (PubMed:9039502)Curated
Sequence conflicti617 – 6171G → F in BAA13210. (PubMed:9039502)Curated
Sequence conflicti621 – 6233PQQ → HQP in BAA13210. (PubMed:9039502)Curated
Sequence conflicti622 – 6232QQ → ER in BAD92869. 1 PublicationCurated
Sequence conflicti664 – 6641Q → E in BAD92869. 1 PublicationCurated
Sequence conflicti675 – 6751V → I in BAA13210. (PubMed:9039502)Curated
Sequence conflicti707 – 7071Q → R in BAA13210. (PubMed:9039502)Curated
Sequence conflicti707 – 7071Q → R in BAD92869. 1 PublicationCurated
Sequence conflicti766 – 7661P → T in BAA13210. (PubMed:9039502)Curated
Sequence conflicti825 – 8251P → S in AAH73943. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 216216Missing in isoform 4. 1 PublicationVSP_021832Add
BLAST
Alternative sequencei1 – 4040MVKLS…EYLRK → MFCCLGYEWLSGGCKTWHSA W in isoform 3. 1 PublicationVSP_021833Add
BLAST
Alternative sequencei290 – 32738Missing in isoform 5. 1 PublicationVSP_021834Add
BLAST
Alternative sequencei413 – 576164Missing in isoform 5. 1 PublicationVSP_021835Add
BLAST
Alternative sequencei515 – 928414Missing in isoform 4. 1 PublicationVSP_021836Add
BLAST
Alternative sequencei515 – 886372Missing in isoform 2. 1 PublicationVSP_021837Add
BLAST
Alternative sequencei577 – 868292Missing in isoform 3. 1 PublicationVSP_021838Add
BLAST
Alternative sequencei785 – 82642ERLRG…IKTPA → GRFHPQRMIISRHLPSVSSL PFHPQLHPQQMIISRHLPSV CG in isoform 5. 1 PublicationVSP_021839Add
BLAST
Alternative sequencei947 – 97428Missing in isoform 6. 1 PublicationVSP_033367Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D86974 mRNA. Translation: BAA13210.2. Sequence problems.
AB209632 Transcribed RNA. Translation: BAD92869.1. Different initiation.
AC008740 Genomic DNA. No translation available.
BC036263 mRNA. Translation: AAH36263.1.
BC061522 mRNA. Translation: AAH61522.1.
BC073943 mRNA. Translation: AAH73943.1.
BC094882 mRNA. Translation: AAH94882.1.
AY498718 mRNA. Translation: AAS48701.1.
RefSeqiNP_569731.2. NM_130464.2.
UniGeneiHs.611072.
Hs.632865.
Hs.656872.
Hs.720286.

Genome annotation databases

EnsembliENST00000542817; ENSP00000444096; ENSG00000169246. [Q92617-4]
GeneIDi23117.
KEGGihsa:23117.
UCSCiuc002djq.3. human. [Q92617-2]
uc021tem.1. human. [Q92617-3]

Polymorphism databases

DMDMi215274263.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D86974 mRNA. Translation: BAA13210.2 . Sequence problems.
AB209632 Transcribed RNA. Translation: BAD92869.1 . Different initiation.
AC008740 Genomic DNA. No translation available.
BC036263 mRNA. Translation: AAH36263.1 .
BC061522 mRNA. Translation: AAH61522.1 .
BC073943 mRNA. Translation: AAH73943.1 .
BC094882 mRNA. Translation: AAH94882.1 .
AY498718 mRNA. Translation: AAS48701.1 .
RefSeqi NP_569731.2. NM_130464.2.
UniGenei Hs.611072.
Hs.632865.
Hs.656872.
Hs.720286.

3D structure databases

ProteinModelPortali Q92617.
SMRi Q92617. Positions 1-41.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q92617. 2 interactions.
STRINGi 9606.ENSP00000399107.

PTM databases

PhosphoSitei Q92617.

Polymorphism databases

DMDMi 215274263.

Proteomic databases

PaxDbi Q92617.
PRIDEi Q92617.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000542817 ; ENSP00000444096 ; ENSG00000169246 . [Q92617-4 ]
GeneIDi 23117.
KEGGi hsa:23117.
UCSCi uc002djq.3. human. [Q92617-2 ]
uc021tem.1. human. [Q92617-3 ]

Organism-specific databases

CTDi 23117.
GeneCardsi GC16M021414.
H-InvDB HIX0173283.
HGNCi HGNC:28989. NPIPB3.
neXtProti NX_Q92617.
PharmGKBi PA164724182.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00540000072033.
HOVERGENi HBG052821.
InParanoidi Q92617.
PhylomeDBi Q92617.

Miscellaneous databases

GenomeRNAii 23117.
NextBioi 44328.
PROi Q92617.

Gene expression databases

Bgeei Q92617.
ExpressionAtlasi Q92617. baseline.
Genevestigatori Q92617.

Family and domain databases

InterProi IPR009443. NPIP.
[Graphical view ]
PANTHERi PTHR15438. PTHR15438. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Spleen.
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 690-1050 (ISOFORM 1).
    Tissue: Lymph, Mammary carcinoma, Pancreas and PNS.
  5. "Cloning and identification of a new protein coding gene pps22-1 binding with promoter DNA of pre-pre-S gene of hepatitis B virus."
    Huang Y.-P., Cheng J., Yang Y.-J.
    Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 917-1050 (ISOFORM 6).

Entry informationi

Entry nameiNPIB3_HUMAN
AccessioniPrimary (citable) accession number: Q92617
Secondary accession number(s): O43332
, Q504Q6, Q59F29, Q6GMR1, Q6P7T2, Q6PIE2, Q6RH21
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 25, 2008
Last modified: October 29, 2014
This is version 98 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3