Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q925T6

- GRIP1_MOUSE

UniProt

Q925T6 - GRIP1_MOUSE

Protein

Glutamate receptor-interacting protein 1

Gene

Grip1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.By similarity

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. protein localization Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Glutamate receptor-interacting protein 1
    Short name:
    GRIP-1
    Gene namesi
    Name:Grip1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 10

    Organism-specific databases

    MGIiMGI:1921303. Grip1.

    Subcellular locationi

    Cytoplasmic vesicle. Endoplasmic reticulum. Cell junctionsynapsepostsynaptic cell membrane By similarity
    Note: Cytoplasmic and membrane-associated with vesicles, peri-Golgi complexes and endoplasmic reticulum. Enriched in postsynaptic plasma membrane and postsynaptic densities By similarity. The palmitoylated form of isoform 2 is exclusively membrane-associated.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytoplasmic membrane-bounded vesicle Source: UniProtKB-SubCell
    3. dendrite Source: MGI
    4. endoplasmic reticulum Source: UniProtKB-SubCell
    5. membrane raft Source: MGI
    6. neuron projection Source: BHF-UCL
    7. plasma membrane Source: BHF-UCL
    8. postsynaptic membrane Source: UniProtKB-SubCell
    9. recycling endosome Source: MGI

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11271127Glutamate receptor-interacting protein 1PRO_0000083850Add
    BLAST

    Post-translational modificationi

    Palmitoylation of isoform 2.1 Publication

    Keywords - PTMi

    Lipoprotein, Palmitate

    Proteomic databases

    MaxQBiQ925T6.
    PaxDbiQ925T6.
    PRIDEiQ925T6.

    PTM databases

    PhosphoSiteiQ925T6.

    Expressioni

    Tissue specificityi

    Expressed in brain. Isoform 2 is the major isoform in brain. Expressed in oligodendrocyte lineage cells.2 Publications

    Developmental stagei

    Detected in early development between postnatal days 3 (P3) and P8 and decreased from P14 in forebrain and cerebellum.1 Publication

    Gene expression databases

    BgeeiQ925T6.
    CleanExiMM_GRIP1.
    GenevestigatoriQ925T6.

    Interactioni

    Subunit structurei

    Interacts with EFNB3, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PTPRF, liprins-alpha and the C-terminal tail of PRLHR. Can form homomultimers or heteromultimers with GRIP2 By similarity. Interacts with EFNB1, EPHA7, EPHB2, KIF5A, KIF5B and KIF5C. Forms a ternary complex with GRIA2 and CSPG4. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 and PLCD4. Interacts with WBSCR22 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Cspg4Q8VHY07EBI-537752,EBI-8327479
    Ephb2P547632EBI-537752,EBI-537711
    Gria2P238195EBI-537752,EBI-77538
    Lrrfip1Q3UZ392EBI-537752,EBI-2270972
    VdrP482812EBI-537752,EBI-346797

    Protein-protein interaction databases

    BioGridi216454. 7 interactions.
    IntActiQ925T6. 13 interactions.
    MINTiMINT-1787557.

    Structurei

    Secondary structure

    1
    1127
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi467 – 4748
    Beta strandi478 – 4825
    Beta strandi484 – 4874
    Beta strandi493 – 4953
    Beta strandi501 – 5055
    Helixi510 – 5134
    Beta strandi523 – 5264
    Beta strandi529 – 5346
    Helixi536 – 54611
    Turni547 – 5504
    Beta strandi552 – 5598

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1V5QNMR-A461-569[»]
    ProteinModelPortaliQ925T6.
    SMRiQ925T6. Positions 48-343, 463-755, 995-1085.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ925T6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini53 – 13684PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini150 – 23889PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini252 – 33685PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini471 – 56090PDZ 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini572 – 65786PDZ 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini672 – 75483PDZ 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini1003 – 108583PDZ 7PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 6 mediates interaction with the C-terminal of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. PDZ 4 and PDZ 5 mediate interaction with PRLHR By similarity. PDZ 7 domain binds CSPG4.By similarity1 Publication

    Sequence similaritiesi

    Contains 7 PDZ (DHR) domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG297474.
    GeneTreeiENSGT00390000013494.
    HOGENOMiHOG000043120.
    HOVERGENiHBG051841.
    InParanoidiQ925T6.
    OMAiKKQTDAQ.
    PhylomeDBiQ925T6.
    TreeFamiTF326909.

    Family and domain databases

    Gene3Di2.30.42.10. 7 hits.
    InterProiIPR001478. PDZ.
    [Graphical view]
    PfamiPF00595. PDZ. 7 hits.
    [Graphical view]
    SMARTiSM00228. PDZ. 7 hits.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 7 hits.
    PROSITEiPS50106. PDZ. 7 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q925T6-1) [UniParc]FASTAAdd to Basket

    Also known as: GRIP1a-L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG     50
    STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY 100
    IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS VQGSSVMFRT 150
    VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG 200
    DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV MDSVATASGP 250
    LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH 300
    ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI 350
    QRSDRQHPWD AWASNQCGVH TNHHHNTYHP DHCRVPALTF PKALPPNSPP 400
    AMVPSSSPTS MSAYSLSSLN MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS 450
    LSLASSTVGL AGQVVHTETT EVVLTADPVT GFGIQLQGSV FATETLSSPP 500
    LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN QLLRDSSITS 550
    KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV 600
    ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DNCSMEDAVQ ILQQCEDLVK 650
    LKIRKDEDNS DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS 700
    LTKGGLAERT GAIHIGDRIL AINSSSLKGK PLSEAIHLLQ MAGETVTLKI 750
    KKQTDAQSAS SPKKFPIPGH SGDLGDGEED PSPIQKPGKL SDAYPSTVPS 800
    VDSAVDSWDG SGIDASYGSQ GSTFQTSGYN YNTYDWRSPK QRTSLSPVPK 850
    PRSQTYPDVG LSNEDWDRST ASGFVGASDS ADAEQEENFW SQALEDLETC 900
    GQSGILRELE EKADRRVSLR NMTLLATIMS GSTMSLNHEA PMARSQLGRQ 950
    ASFQERSSSR PHYSQTTRSN TLPSDVGRKS VTLRKMKQEI KEIMSPTPVE 1000
    LHKVTLYKDS GMEDFGFSVA DGLLEKGVYV KNIRPAGPGD VGGLKPYDRL 1050
    LQVNHVRTRD FDCCLVVPLI AESGNKLDLV ISRNPLASQK SIEQPALPSD 1100
    WSEQNSAFFQ QPSHGGNLET REPTNTL 1127
    Length:1,127
    Mass (Da):122,058
    Last modified:December 1, 2001 - v1
    Checksum:i556DFCCE2CE6248A
    GO
    Isoform 2 (identifier: Q925T6-2) [UniParc]FASTAAdd to Basket

    Also known as: GRIP1b, GRIP1b-S

    The sequence of this isoform differs from the canonical sequence as follows:
         1-45: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIP → MPGWKKNIPICLQAEEQER
         348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
         911-925: Missing.

    Note: Major isoform. Contains a S-palmitoyl cysteine at position 11.

    Show »
    Length:1,034
    Mass (Da):111,487
    Checksum:i91DF2CDD7367028A
    GO
    Isoform 3 (identifier: Q925T6-3) [UniParc]FASTAAdd to Basket

    Also known as: GRIP1a-S

    The sequence of this isoform differs from the canonical sequence as follows:
         19-45: Missing.
         348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
         911-925: Missing.

    Note: May be due to exons 2, 10 and 11 skipping. No experimental confirmation available.

    Show »
    Length:1,033
    Mass (Da):111,383
    Checksum:i82F04408111C9AF2
    GO
    Isoform 4 (identifier: Q925T6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-415: Missing.
         416-451: LSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTAKRAERKEMKRPNSFHLPFRPSLRKGQKKNAAHV
         756-820: Missing.
         911-925: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:632
    Mass (Da):68,966
    Checksum:i172ACDBA40467E43
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1011 – 10111G → C in BAC26668. (PubMed:16141072)Curated
    Sequence conflicti1044 – 10441L → M in BAC31662. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 415415Missing in isoform 4. 1 PublicationVSP_009745Add
    BLAST
    Alternative sequencei1 – 4545MIAVS…RQSIP → MPGWKKNIPICLQAEEQER in isoform 2. 1 PublicationVSP_009744Add
    BLAST
    Alternative sequencei19 – 4527Missing in isoform 3. 1 PublicationVSP_009746Add
    BLAST
    Alternative sequencei348 – 40053VKIQR…PNSPP → A in isoform 2 and isoform 3. 1 PublicationVSP_009747Add
    BLAST
    Alternative sequencei416 – 45136LSSLN…FKSSL → MTAKRAERKEMKRPNSFHLP FRPSLRKGQKKNAAHV in isoform 4. 1 PublicationVSP_009748Add
    BLAST
    Alternative sequencei756 – 82065Missing in isoform 4. 1 PublicationVSP_009749Add
    BLAST
    Alternative sequencei911 – 92515Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_009750Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB051560 mRNA. Translation: BAB46929.1.
    AB051561 mRNA. Translation: BAB46930.1.
    AB051562 mRNA. Translation: BAB46931.1.
    AK029905 mRNA. Translation: BAC26668.1.
    AK043821 mRNA. Translation: BAC31662.2.
    CCDSiCCDS24202.1. [Q925T6-1]
    CCDS36071.1. [Q925T6-2]
    CCDS36072.1. [Q925T6-3]
    CCDS70114.1. [Q925T6-4]
    RefSeqiNP_001264221.1. NM_001277292.1.
    NP_001264223.1. NM_001277294.1.
    NP_001264224.1. NM_001277295.1. [Q925T6-4]
    NP_083012.1. NM_028736.2. [Q925T6-1]
    NP_570961.1. NM_130891.2. [Q925T6-3]
    NP_597699.1. NM_133442.2. [Q925T6-2]
    UniGeneiMm.196692.

    Genome annotation databases

    EnsembliENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813. [Q925T6-2]
    ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813. [Q925T6-4]
    ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813. [Q925T6-1]
    ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813. [Q925T6-3]
    GeneIDi74053.
    KEGGimmu:74053.
    UCSCiuc007heg.1. mouse. [Q925T6-2]
    uc007hek.1. mouse. [Q925T6-1]
    uc007hel.1. mouse. [Q925T6-3]
    uc007hep.1. mouse. [Q925T6-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB051560 mRNA. Translation: BAB46929.1 .
    AB051561 mRNA. Translation: BAB46930.1 .
    AB051562 mRNA. Translation: BAB46931.1 .
    AK029905 mRNA. Translation: BAC26668.1 .
    AK043821 mRNA. Translation: BAC31662.2 .
    CCDSi CCDS24202.1. [Q925T6-1 ]
    CCDS36071.1. [Q925T6-2 ]
    CCDS36072.1. [Q925T6-3 ]
    CCDS70114.1. [Q925T6-4 ]
    RefSeqi NP_001264221.1. NM_001277292.1.
    NP_001264223.1. NM_001277294.1.
    NP_001264224.1. NM_001277295.1. [Q925T6-4 ]
    NP_083012.1. NM_028736.2. [Q925T6-1 ]
    NP_570961.1. NM_130891.2. [Q925T6-3 ]
    NP_597699.1. NM_133442.2. [Q925T6-2 ]
    UniGenei Mm.196692.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1V5Q NMR - A 461-569 [» ]
    ProteinModelPortali Q925T6.
    SMRi Q925T6. Positions 48-343, 463-755, 995-1085.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 216454. 7 interactions.
    IntActi Q925T6. 13 interactions.
    MINTi MINT-1787557.

    PTM databases

    PhosphoSitei Q925T6.

    Proteomic databases

    MaxQBi Q925T6.
    PaxDbi Q925T6.
    PRIDEi Q925T6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000077871 ; ENSMUSP00000077033 ; ENSMUSG00000034813 . [Q925T6-2 ]
    ENSMUST00000105261 ; ENSMUSP00000100896 ; ENSMUSG00000034813 . [Q925T6-4 ]
    ENSMUST00000138410 ; ENSMUSP00000123234 ; ENSMUSG00000034813 . [Q925T6-1 ]
    ENSMUST00000144825 ; ENSMUSP00000121670 ; ENSMUSG00000034813 . [Q925T6-3 ]
    GeneIDi 74053.
    KEGGi mmu:74053.
    UCSCi uc007heg.1. mouse. [Q925T6-2 ]
    uc007hek.1. mouse. [Q925T6-1 ]
    uc007hel.1. mouse. [Q925T6-3 ]
    uc007hep.1. mouse. [Q925T6-4 ]

    Organism-specific databases

    CTDi 23426.
    MGIi MGI:1921303. Grip1.

    Phylogenomic databases

    eggNOGi NOG297474.
    GeneTreei ENSGT00390000013494.
    HOGENOMi HOG000043120.
    HOVERGENi HBG051841.
    InParanoidi Q925T6.
    OMAi KKQTDAQ.
    PhylomeDBi Q925T6.
    TreeFami TF326909.

    Miscellaneous databases

    ChiTaRSi GRIP1. mouse.
    EvolutionaryTracei Q925T6.
    NextBioi 339644.
    PROi Q925T6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q925T6.
    CleanExi MM_GRIP1.
    Genevestigatori Q925T6.

    Family and domain databases

    Gene3Di 2.30.42.10. 7 hits.
    InterProi IPR001478. PDZ.
    [Graphical view ]
    Pfami PF00595. PDZ. 7 hits.
    [Graphical view ]
    SMARTi SM00228. PDZ. 7 hits.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 7 hits.
    PROSITEi PS50106. PDZ. 7 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Differential palmitoylation of two mouse glutamate receptor interacting protein 1 forms with different N-terminal sequences."
      Yamazaki M., Fukaya M., Abe M., Ikeno K., Kakizaki T., Watanabe M., Sakimura K.
      Neurosci. Lett. 304:81-84(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, PALMITOYLATION OF ISOFORM 2.
      Tissue: Brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Strain: C57BL/6J.
      Tissue: Testis.
    3. "PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands."
      Torres R., Firestein B.L., Dong H., Staudinger J., Olson E.N., Huganir R.L., Bredt D.S., Gale N.W., Yancopoulos G.D.
      Neuron 21:1453-1463(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH EFNB1; EPHA7 AND EPHB2.
    4. "Glutamate-receptor-interacting protein GRIP1 directly steers kinesin to dendrites."
      Setou M., Seog D.-H., Tanaka Y., Kanai Y., Takei Y., Kawagishi M., Hirokawa N.
      Nature 417:83-87(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KIF5A; KIF5B AND KIF5C.
    5. "The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling."
      Stegmueller J., Werner H., Nave K.-A., Trotter J.
      J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CSPG4 AND GRIA2, DOMAIN, TISSUE SPECIFICITY.
    6. "Phospholipase Cdelta4 associates with glutamate receptor interacting protein 1 in testis."
      Irino Y., Ichinohe M., Nakamura Y., Nakahara M., Fukami K.
      J. Biochem. 138:451-456(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PLCD4.
    7. "GAC63, a GRIP1-dependent nuclear receptor coactivator."
      Chen Y.-H., Kim J.H., Stallcup M.R.
      Mol. Cell. Biol. 25:5965-5972(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SLC30A9.
    8. "The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior."
      Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L.
      Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ATAD1 AND GRIA2.
    9. "Solution structure of the PDZ domain from mouse glutamate receptor interacting protein 1A-L (GRIP1) homolog."
      RIKEN structural genomics initiative (RSGI)
      Submitted (MAY-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 461-570.

    Entry informationi

    Entry nameiGRIP1_MOUSE
    AccessioniPrimary (citable) accession number: Q925T6
    Secondary accession number(s): Q8BLQ3
    , Q8C0T3, Q925T5, Q925T7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 29, 2004
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 111 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3