Q925T6 (GRIP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamate receptor-interacting protein 1 Short name=GRIP-1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1127 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons By similarity. |
| Subunit structure | Interacts with EFNB3, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PTPRF, liprins-alpha and the C-terminal tail of PRLHR. Can form homomultimers or heteromultimers with GRIP2 By similarity. Interacts with EFNB1, EPHA7, EPHB2, KIF5A, KIF5B and KIF5C. Forms a ternary complex with GRIA2 and CSPG4. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 and PLCD4. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.9 |
| Subcellular location | Cytoplasmic vesicle. Endoplasmic reticulum. Cell junction › synapse › postsynaptic cell membrane By similarity. Note: Cytoplasmic and membrane-associated with vesicles, peri-Golgi complexes and endoplasmic reticulum. Enriched in postsynaptic plasma membrane and postsynaptic densities By similarity. The palmitoylated form of isoform 2 is exclusively membrane-associated. Isoform 2: Membrane; Lipid-anchor. |
| Tissue specificity | Expressed in brain. Isoform 2 is the major isoform in brain. Expressed in oligodendrocyte lineage cells. Ref.1 Ref.5 |
| Developmental stage | Detected in early development between postnatal days 3 (P3) and P8 and decreased from P14 in forebrain and cerebellum. Ref.1 |
| Domain | PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 6 mediates interaction with the C-terminal of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. PDZ 4 and PDZ 5 mediate interaction with PRLHR By similarity. PDZ 7 domain binds CSPG4. Ref.5 |
| Post-translational modification | |
| Sequence similarities | Contains 7 PDZ (DHR) domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Ephb2 | P54763 | 2 | EBI-537752,EBI-537711 | |
| Lrrfip1 | Q3UZ39 | 2 | EBI-537752,EBI-2270972 | |
| Vdr | P48281 | 2 | EBI-537752,EBI-346797 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q925T6-1) Also known as: GRIP1a-L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q925T6-2) Also known as: GRIP1b; GRIP1b-S; The sequence of this isoform differs from the canonical sequence as follows: 1-45: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIP → MPGWKKNIPICLQAEEQER 348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A 911-925: Missing. | ||||||
| Note: Major isoform. Contains a S-palmitoyl cysteine at position 11. | ||||||
| Isoform 3 (identifier: Q925T6-3) Also known as: GRIP1a-S; The sequence of this isoform differs from the canonical sequence as follows: 19-45: Missing. 348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A 911-925: Missing. | ||||||
| Note: May be due to exons 2, 10 and 11 skipping. No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q925T6-4) The sequence of this isoform differs from the canonical sequence as follows: 1-415: Missing. 416-451: LSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTAKRAERKEMKRPNSFHLPFRPSLRKGQKKNAAHV 756-820: Missing. 911-925: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1127 | 1127 | Glutamate receptor-interacting protein 1 | PRO_0000083850 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Domain | 53 – 136 | 84 | PDZ 1 | |||||||||||||||||||||||||||
| Domain | 150 – 238 | 89 | PDZ 2 | |||||||||||||||||||||||||||
| Domain | 252 – 336 | 85 | PDZ 3 | |||||||||||||||||||||||||||
| Domain | 471 – 560 | 90 | PDZ 4 | |||||||||||||||||||||||||||
| Domain | 572 – 657 | 86 | PDZ 5 | |||||||||||||||||||||||||||
| Domain | 672 – 754 | 83 | PDZ 6 | |||||||||||||||||||||||||||
| Domain | 1003 – 1085 | 83 | PDZ 7 | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 43 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 415 | 415 | Missing in isoform 4. | VSP_009745 | ||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | MIAVS…RQSIP → MPGWKKNIPICLQAEEQER in isoform 2. | VSP_009744 | ||||||||||||||||||||||||||
| Alternative sequence | 19 – 45 | 27 | Missing in isoform 3. | VSP_009746 | ||||||||||||||||||||||||||
| Alternative sequence | 348 – 400 | 53 | VKIQR…PNSPP → A in isoform 2 and isoform 3. | VSP_009747 | ||||||||||||||||||||||||||
| Alternative sequence | 416 – 451 | 36 | LSSLN…FKSSL → MTAKRAERKEMKRPNSFHLP FRPSLRKGQKKNAAHV in isoform 4. | VSP_009748 | ||||||||||||||||||||||||||
| Alternative sequence | 756 – 820 | 65 | Missing in isoform 4. | VSP_009749 | ||||||||||||||||||||||||||
| Alternative sequence | 911 – 925 | 15 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_009750 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Sequence conflict | 1011 | 1 | G → C in BAC26668. Ref.2 | |||||||||||||||||||||||||||
| Sequence conflict | 1044 | 1 | L → M in BAC31662. Ref.2 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 467 – 474 | 8 | ||||||||||||||||||||||||||||
| Beta strand | 478 – 482 | 5 | ||||||||||||||||||||||||||||
| Beta strand | 484 – 487 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 493 – 495 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 501 – 505 | 5 | ||||||||||||||||||||||||||||
| Helix | 510 – 513 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 523 – 526 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 529 – 534 | 6 | ||||||||||||||||||||||||||||
| Helix | 536 – 546 | 11 | ||||||||||||||||||||||||||||
| Turn | 547 – 550 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 552 – 559 | 8 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential palmitoylation of two mouse glutamate receptor interacting protein 1 forms with different N-terminal sequences." Yamazaki M., Fukaya M., Abe M., Ikeno K., Kakizaki T., Watanabe M., Sakimura K. Neurosci. Lett. 304:81-84(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, PALMITOYLATION OF ISOFORM 2. Tissue: Brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Strain: C57BL/6J. Tissue: Testis. |
| [3] | "PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands." Torres R., Firestein B.L., Dong H., Staudinger J., Olson E.N., Huganir R.L., Bredt D.S., Gale N.W., Yancopoulos G.D. Neuron 21:1453-1463(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EFNB1; EPHA7 AND EPHB2. |
| [4] | "Glutamate-receptor-interacting protein GRIP1 directly steers kinesin to dendrites." Setou M., Seog D.-H., Tanaka Y., Kanai Y., Takei Y., Kawagishi M., Hirokawa N. Nature 417:83-87(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KIF5A; KIF5B AND KIF5C. |
| [5] | "The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling." Stegmueller J., Werner H., Nave K.-A., Trotter J. J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CSPG4 AND GRIA2, DOMAIN, TISSUE SPECIFICITY. |
| [6] | "Phospholipase Cdelta4 associates with glutamate receptor interacting protein 1 in testis." Irino Y., Ichinohe M., Nakamura Y., Nakahara M., Fukami K. J. Biochem. 138:451-456(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PLCD4. |
| [7] | "GAC63, a GRIP1-dependent nuclear receptor coactivator." Chen Y.-H., Kim J.H., Stallcup M.R. Mol. Cell. Biol. 25:5965-5972(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SLC30A9. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-43, MASS SPECTROMETRY. Tissue: Melanoma. |
| [9] | "The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior." Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L. Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATAD1 AND GRIA2. |
| [10] | "Solution structure of the PDZ domain from mouse glutamate receptor interacting protein 1A-L (GRIP1) homolog." RIKEN structural genomics initiative (RSGI) Submitted (MAY-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 461-570. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB051560 mRNA. Translation: BAB46929.1. AB051561 mRNA. Translation: BAB46930.1. AB051562 mRNA. Translation: BAB46931.1. AK029905 mRNA. Translation: BAC26668.1. AK043821 mRNA. Translation: BAC31662.2. | ||||||||||||
| IPI | IPI00127232. IPI00269503. IPI00399863. IPI00409947. | ||||||||||||
| RefSeq | NP_001264224.1. NM_001277295.1. NP_083012.1. NM_028736.2. NP_570961.1. NM_130891.2. NP_597699.1. NM_133442.2. | ||||||||||||
| UniGene | Mm.196692. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q925T6. | ||||||||||||
| SMR | Q925T6. Positions 48-343, 463-755, 995-1085. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q925T6. 8 interactions. | ||||||||||||
| MINT | MINT-1787557. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q925T6. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q925T6. | ||||||||||||
| PRIDE | Q925T6. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813. ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813. ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813. ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813. | ||||||||||||
| GeneID | 74053. | ||||||||||||
| KEGG | mmu:74053. | ||||||||||||
| UCSC | uc007heg.1. mouse. uc007hek.1. mouse. uc007hel.1. mouse. uc007hep.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 23426. | ||||||||||||
| MGI | MGI:1921303. Grip1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG297474. | ||||||||||||
| GeneTree | ENSGT00390000013494. | ||||||||||||
| HOGENOM | HOG000043120. | ||||||||||||
| HOVERGEN | HBG051841. | ||||||||||||
| InParanoid | Q925T6. | ||||||||||||
| OMA | KKQTDAQ. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q925T6. | ||||||||||||
| Bgee | Q925T6. | ||||||||||||
| CleanEx | MM_GRIP1. | ||||||||||||
| Genevestigator | Q925T6. | ||||||||||||
| GermOnline | ENSMUSG00000034813. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001478. PDZ. [Graphical view] | ||||||||||||
| Pfam | PF00595. PDZ. 7 hits. [Graphical view] | ||||||||||||
| SMART | SM00228. PDZ. 7 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 7 hits. | ||||||||||||
| PROSITE | PS50106. PDZ. 7 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | GRIP1. mouse. | ||||||||||||
| EvolutionaryTrace | Q925T6. | ||||||||||||
| NextBio | 339644. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | GRIP1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q925T6 Secondary accession number(s): Q8BLQ3 Q925T7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
