SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q925T6

- GRIP1_MOUSE

UniProt

Q925T6 - GRIP1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Glutamate receptor-interacting protein 1

Gene
Grip1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons By similarity.

GO - Molecular functioni

  1. protein binding Source: UniProtKB

GO - Biological processi

  1. protein localization Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
Gene namesi
Name:Grip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 10

Organism-specific databases

MGIiMGI:1921303. Grip1.

Subcellular locationi

Cytoplasmic vesicle. Endoplasmic reticulum. Cell junctionsynapsepostsynaptic cell membrane By similarity
Note: Cytoplasmic and membrane-associated with vesicles, peri-Golgi complexes and endoplasmic reticulum. Enriched in postsynaptic plasma membrane and postsynaptic densities By similarity. The palmitoylated form of isoform 2 is exclusively membrane-associated.

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoplasmic membrane-bounded vesicle Source: UniProtKB-SubCell
  3. dendrite Source: MGI
  4. endoplasmic reticulum Source: UniProtKB-SubCell
  5. membrane raft Source: MGI
  6. neuron projection Source: BHF-UCL
  7. plasma membrane Source: BHF-UCL
  8. postsynaptic membrane Source: UniProtKB-SubCell
  9. recycling endosome Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11271127Glutamate receptor-interacting protein 1PRO_0000083850Add
BLAST

Post-translational modificationi

Palmitoylation of isoform 2.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

MaxQBiQ925T6.
PaxDbiQ925T6.
PRIDEiQ925T6.

PTM databases

PhosphoSiteiQ925T6.

Expressioni

Tissue specificityi

Expressed in brain. Isoform 2 is the major isoform in brain. Expressed in oligodendrocyte lineage cells.2 Publications

Developmental stagei

Detected in early development between postnatal days 3 (P3) and P8 and decreased from P14 in forebrain and cerebellum.1 Publication

Gene expression databases

BgeeiQ925T6.
CleanExiMM_GRIP1.
GenevestigatoriQ925T6.

Interactioni

Subunit structurei

Interacts with EFNB3, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PTPRF, liprins-alpha and the C-terminal tail of PRLHR. Can form homomultimers or heteromultimers with GRIP2 By similarity. Interacts with EFNB1, EPHA7, EPHB2, KIF5A, KIF5B and KIF5C. Forms a ternary complex with GRIA2 and CSPG4. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 and PLCD4. Interacts with WBSCR22 By similarity.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Cspg4Q8VHY07EBI-537752,EBI-8327479
Ephb2P547632EBI-537752,EBI-537711
Gria2P238195EBI-537752,EBI-77538
Lrrfip1Q3UZ392EBI-537752,EBI-2270972
VdrP482812EBI-537752,EBI-346797

Protein-protein interaction databases

BioGridi216454. 7 interactions.
IntActiQ925T6. 13 interactions.
MINTiMINT-1787557.

Structurei

Secondary structure

1
1127
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi467 – 4748
Beta strandi478 – 4825
Beta strandi484 – 4874
Beta strandi493 – 4953
Beta strandi501 – 5055
Helixi510 – 5134
Beta strandi523 – 5264
Beta strandi529 – 5346
Helixi536 – 54611
Turni547 – 5504
Beta strandi552 – 5598

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1V5QNMR-A461-569[»]
ProteinModelPortaliQ925T6.
SMRiQ925T6. Positions 48-343, 463-755, 995-1085.

Miscellaneous databases

EvolutionaryTraceiQ925T6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini53 – 13684PDZ 1Add
BLAST
Domaini150 – 23889PDZ 2Add
BLAST
Domaini252 – 33685PDZ 3Add
BLAST
Domaini471 – 56090PDZ 4Add
BLAST
Domaini572 – 65786PDZ 5Add
BLAST
Domaini672 – 75483PDZ 6Add
BLAST
Domaini1003 – 108583PDZ 7Add
BLAST

Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 6 mediates interaction with the C-terminal of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. PDZ 4 and PDZ 5 mediate interaction with PRLHR By similarity. PDZ 7 domain binds CSPG4.1 Publication

Sequence similaritiesi

Contains 7 PDZ (DHR) domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG297474.
GeneTreeiENSGT00390000013494.
HOGENOMiHOG000043120.
HOVERGENiHBG051841.
InParanoidiQ925T6.
OMAiKKQTDAQ.
PhylomeDBiQ925T6.
TreeFamiTF326909.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q925T6-1) [UniParc]FASTAAdd to Basket

Also known as: GRIP1a-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG     50
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY 100
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS VQGSSVMFRT 150
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG 200
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV MDSVATASGP 250
LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH 300
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI 350
QRSDRQHPWD AWASNQCGVH TNHHHNTYHP DHCRVPALTF PKALPPNSPP 400
AMVPSSSPTS MSAYSLSSLN MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS 450
LSLASSTVGL AGQVVHTETT EVVLTADPVT GFGIQLQGSV FATETLSSPP 500
LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN QLLRDSSITS 550
KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV 600
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DNCSMEDAVQ ILQQCEDLVK 650
LKIRKDEDNS DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS 700
LTKGGLAERT GAIHIGDRIL AINSSSLKGK PLSEAIHLLQ MAGETVTLKI 750
KKQTDAQSAS SPKKFPIPGH SGDLGDGEED PSPIQKPGKL SDAYPSTVPS 800
VDSAVDSWDG SGIDASYGSQ GSTFQTSGYN YNTYDWRSPK QRTSLSPVPK 850
PRSQTYPDVG LSNEDWDRST ASGFVGASDS ADAEQEENFW SQALEDLETC 900
GQSGILRELE EKADRRVSLR NMTLLATIMS GSTMSLNHEA PMARSQLGRQ 950
ASFQERSSSR PHYSQTTRSN TLPSDVGRKS VTLRKMKQEI KEIMSPTPVE 1000
LHKVTLYKDS GMEDFGFSVA DGLLEKGVYV KNIRPAGPGD VGGLKPYDRL 1050
LQVNHVRTRD FDCCLVVPLI AESGNKLDLV ISRNPLASQK SIEQPALPSD 1100
WSEQNSAFFQ QPSHGGNLET REPTNTL 1127
Length:1,127
Mass (Da):122,058
Last modified:December 1, 2001 - v1
Checksum:i556DFCCE2CE6248A
GO
Isoform 2 (identifier: Q925T6-2) [UniParc]FASTAAdd to Basket

Also known as: GRIP1b, GRIP1b-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIP → MPGWKKNIPICLQAEEQER
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.

Note: Major isoform. Contains a S-palmitoyl cysteine at position 11.

Show »
Length:1,034
Mass (Da):111,487
Checksum:i91DF2CDD7367028A
GO
Isoform 3 (identifier: Q925T6-3) [UniParc]FASTAAdd to Basket

Also known as: GRIP1a-S

The sequence of this isoform differs from the canonical sequence as follows:
     19-45: Missing.
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.

Note: May be due to exons 2, 10 and 11 skipping. No experimental confirmation available.

Show »
Length:1,033
Mass (Da):111,383
Checksum:i82F04408111C9AF2
GO
Isoform 4 (identifier: Q925T6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-415: Missing.
     416-451: LSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTAKRAERKEMKRPNSFHLPFRPSLRKGQKKNAAHV
     756-820: Missing.
     911-925: Missing.

Note: No experimental confirmation available.

Show »
Length:632
Mass (Da):68,966
Checksum:i172ACDBA40467E43
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 415415Missing in isoform 4. VSP_009745Add
BLAST
Alternative sequencei1 – 4545MIAVS…RQSIP → MPGWKKNIPICLQAEEQER in isoform 2. VSP_009744Add
BLAST
Alternative sequencei19 – 4527Missing in isoform 3. VSP_009746Add
BLAST
Alternative sequencei348 – 40053VKIQR…PNSPP → A in isoform 2 and isoform 3. VSP_009747Add
BLAST
Alternative sequencei416 – 45136LSSLN…FKSSL → MTAKRAERKEMKRPNSFHLP FRPSLRKGQKKNAAHV in isoform 4. VSP_009748Add
BLAST
Alternative sequencei756 – 82065Missing in isoform 4. VSP_009749Add
BLAST
Alternative sequencei911 – 92515Missing in isoform 2, isoform 3 and isoform 4. VSP_009750Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1011 – 10111G → C in BAC26668. 1 Publication
Sequence conflicti1044 – 10441L → M in BAC31662. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB051560 mRNA. Translation: BAB46929.1.
AB051561 mRNA. Translation: BAB46930.1.
AB051562 mRNA. Translation: BAB46931.1.
AK029905 mRNA. Translation: BAC26668.1.
AK043821 mRNA. Translation: BAC31662.2.
CCDSiCCDS24202.1. [Q925T6-1]
CCDS36071.1. [Q925T6-2]
CCDS36072.1. [Q925T6-3]
CCDS70114.1. [Q925T6-4]
RefSeqiNP_001264221.1. NM_001277292.1.
NP_001264223.1. NM_001277294.1.
NP_001264224.1. NM_001277295.1. [Q925T6-4]
NP_083012.1. NM_028736.2. [Q925T6-1]
NP_570961.1. NM_130891.2. [Q925T6-3]
NP_597699.1. NM_133442.2. [Q925T6-2]
UniGeneiMm.196692.

Genome annotation databases

EnsembliENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813. [Q925T6-2]
ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813. [Q925T6-4]
ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813. [Q925T6-1]
ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813. [Q925T6-3]
GeneIDi74053.
KEGGimmu:74053.
UCSCiuc007heg.1. mouse. [Q925T6-2]
uc007hek.1. mouse. [Q925T6-1]
uc007hel.1. mouse. [Q925T6-3]
uc007hep.1. mouse. [Q925T6-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB051560 mRNA. Translation: BAB46929.1 .
AB051561 mRNA. Translation: BAB46930.1 .
AB051562 mRNA. Translation: BAB46931.1 .
AK029905 mRNA. Translation: BAC26668.1 .
AK043821 mRNA. Translation: BAC31662.2 .
CCDSi CCDS24202.1. [Q925T6-1 ]
CCDS36071.1. [Q925T6-2 ]
CCDS36072.1. [Q925T6-3 ]
CCDS70114.1. [Q925T6-4 ]
RefSeqi NP_001264221.1. NM_001277292.1.
NP_001264223.1. NM_001277294.1.
NP_001264224.1. NM_001277295.1. [Q925T6-4 ]
NP_083012.1. NM_028736.2. [Q925T6-1 ]
NP_570961.1. NM_130891.2. [Q925T6-3 ]
NP_597699.1. NM_133442.2. [Q925T6-2 ]
UniGenei Mm.196692.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1V5Q NMR - A 461-569 [» ]
ProteinModelPortali Q925T6.
SMRi Q925T6. Positions 48-343, 463-755, 995-1085.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 216454. 7 interactions.
IntActi Q925T6. 13 interactions.
MINTi MINT-1787557.

PTM databases

PhosphoSitei Q925T6.

Proteomic databases

MaxQBi Q925T6.
PaxDbi Q925T6.
PRIDEi Q925T6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000077871 ; ENSMUSP00000077033 ; ENSMUSG00000034813 . [Q925T6-2 ]
ENSMUST00000105261 ; ENSMUSP00000100896 ; ENSMUSG00000034813 . [Q925T6-4 ]
ENSMUST00000138410 ; ENSMUSP00000123234 ; ENSMUSG00000034813 . [Q925T6-1 ]
ENSMUST00000144825 ; ENSMUSP00000121670 ; ENSMUSG00000034813 . [Q925T6-3 ]
GeneIDi 74053.
KEGGi mmu:74053.
UCSCi uc007heg.1. mouse. [Q925T6-2 ]
uc007hek.1. mouse. [Q925T6-1 ]
uc007hel.1. mouse. [Q925T6-3 ]
uc007hep.1. mouse. [Q925T6-4 ]

Organism-specific databases

CTDi 23426.
MGIi MGI:1921303. Grip1.

Phylogenomic databases

eggNOGi NOG297474.
GeneTreei ENSGT00390000013494.
HOGENOMi HOG000043120.
HOVERGENi HBG051841.
InParanoidi Q925T6.
OMAi KKQTDAQ.
PhylomeDBi Q925T6.
TreeFami TF326909.

Miscellaneous databases

ChiTaRSi GRIP1. mouse.
EvolutionaryTracei Q925T6.
NextBioi 339644.
PROi Q925T6.
SOURCEi Search...

Gene expression databases

Bgeei Q925T6.
CleanExi MM_GRIP1.
Genevestigatori Q925T6.

Family and domain databases

Gene3Di 2.30.42.10. 7 hits.
InterProi IPR001478. PDZ.
[Graphical view ]
Pfami PF00595. PDZ. 7 hits.
[Graphical view ]
SMARTi SM00228. PDZ. 7 hits.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 7 hits.
PROSITEi PS50106. PDZ. 7 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Differential palmitoylation of two mouse glutamate receptor interacting protein 1 forms with different N-terminal sequences."
    Yamazaki M., Fukaya M., Abe M., Ikeno K., Kakizaki T., Watanabe M., Sakimura K.
    Neurosci. Lett. 304:81-84(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, PALMITOYLATION OF ISOFORM 2.
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Testis.
  3. "PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands."
    Torres R., Firestein B.L., Dong H., Staudinger J., Olson E.N., Huganir R.L., Bredt D.S., Gale N.W., Yancopoulos G.D.
    Neuron 21:1453-1463(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EFNB1; EPHA7 AND EPHB2.
  4. "Glutamate-receptor-interacting protein GRIP1 directly steers kinesin to dendrites."
    Setou M., Seog D.-H., Tanaka Y., Kanai Y., Takei Y., Kawagishi M., Hirokawa N.
    Nature 417:83-87(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KIF5A; KIF5B AND KIF5C.
  5. "The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling."
    Stegmueller J., Werner H., Nave K.-A., Trotter J.
    J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CSPG4 AND GRIA2, DOMAIN, TISSUE SPECIFICITY.
  6. "Phospholipase Cdelta4 associates with glutamate receptor interacting protein 1 in testis."
    Irino Y., Ichinohe M., Nakamura Y., Nakahara M., Fukami K.
    J. Biochem. 138:451-456(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PLCD4.
  7. "GAC63, a GRIP1-dependent nuclear receptor coactivator."
    Chen Y.-H., Kim J.H., Stallcup M.R.
    Mol. Cell. Biol. 25:5965-5972(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SLC30A9.
  8. "The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior."
    Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L.
    Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATAD1 AND GRIA2.
  9. "Solution structure of the PDZ domain from mouse glutamate receptor interacting protein 1A-L (GRIP1) homolog."
    RIKEN structural genomics initiative (RSGI)
    Submitted (MAY-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 461-570.

Entry informationi

Entry nameiGRIP1_MOUSE
AccessioniPrimary (citable) accession number: Q925T6
Secondary accession number(s): Q8BLQ3
, Q8C0T3, Q925T5, Q925T7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi