Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q925T6 (GRIP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Glutamate receptor-interacting protein 1

Short name=GRIP-1
Gene names
Name:Grip1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1127 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons By similarity.

Subunit structure

Interacts with EFNB3, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PTPRF, liprins-alpha and the C-terminal tail of PRLHR. Can form homomultimers or heteromultimers with GRIP2 By similarity. Interacts with EFNB1, EPHA7, EPHB2, KIF5A, KIF5B and KIF5C. Forms a ternary complex with GRIA2 and CSPG4. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 and PLCD4. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.8

Subcellular location

Cytoplasmic vesicle. Endoplasmic reticulum. Cell junctionsynapsepostsynaptic cell membrane By similarity. Note: Cytoplasmic and membrane-associated with vesicles, peri-Golgi complexes and endoplasmic reticulum. Enriched in postsynaptic plasma membrane and postsynaptic densities By similarity. The palmitoylated form of isoform 2 is exclusively membrane-associated.

Isoform 2: Membrane; Lipid-anchor.

Tissue specificity

Expressed in brain. Isoform 2 is the major isoform inbrain. Expressed in oligodendrocyte lineage cells. Ref.1 Ref.5

Developmental stage

Detected in early development between postnatal days 3 (P3) and P8 and decreased from P14 in forebrain and cerebellum. Ref.1

Domain

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 6 mediates interaction with the C-terminal of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. PDZ 4 and PDZ 5 mediate interaction with PRLHR By similarity. PDZ 7 domain binds CSPG4. Ref.5

Post-translational modification

Palmitoylation of isoform 2. Ref.1

Sequence similarities

Contains 7 PDZ (DHR) domains.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q925T6-1)

Also known as: GRIP1a-L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q925T6-2)

Also known as: GRIP1b; GRIP1b-S;

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIP → MPGWKKNIPICLQAEEQER
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.
Note: Major isoform. Contains a S-palmitoyl cysteine at position 11.
Isoform 3 (identifier: Q925T6-3)

Also known as: GRIP1a-S;

The sequence of this isoform differs from the canonical sequence as follows:
     19-45: Missing.
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.
Note: May be due to exons 2, 10 and 11 skipping. No experimental confirmation available.
Isoform 4 (identifier: Q925T6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-415: Missing.
     416-451: LSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTAKRAERKEMKRPNSFHLPFRPSLRKGQKKNAAHV
     756-820: Missing.
     911-925: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11271127Glutamate receptor-interacting protein 1
PRO_0000083850

Regions

Domain53 – 13684PDZ 1
Domain150 – 23889PDZ 2
Domain252 – 33685PDZ 3
Domain471 – 56090PDZ 4
Domain572 – 65786PDZ 5
Domain672 – 75483PDZ 6
Domain1003 – 108583PDZ 7

Natural variations

Alternative sequence1 – 415415Missing in isoform 4.
VSP_009745
Alternative sequence1 – 4545MIAVS…RQSIP → MPGWKKNIPICLQAEEQER in isoform 2.
VSP_009744
Alternative sequence19 – 4527Missing in isoform 3.
VSP_009746
Alternative sequence348 – 40053VKIQR…PNSPP → A in isoform 2 and isoform 3.
VSP_009747
Alternative sequence416 – 45136LSSLN…FKSSL → MTAKRAERKEMKRPNSFHLP FRPSLRKGQKKNAAHV in isoform 4.
VSP_009748
Alternative sequence756 – 82065Missing in isoform 4.
VSP_009749
Alternative sequence911 – 92515Missing in isoform 2, isoform 3 and isoform 4.
VSP_009750

Experimental info

Sequence conflict10111G → C in BAC26668. Ref.2
Sequence conflict10441L → M in BAC31662. Ref.2

Secondary structure

...................... 1127
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (GRIP1a-L) [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 556DFCCE2CE6248A

FASTA1,127122,058
        10         20         30         40         50         60 
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG STVVELMKKE 

        70         80         90        100        110        120 
GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY IKAVNGINLA KFRHDEIISL 

       130        140        150        160        170        180 
LKNVGERVVL EVEYELPPVS VQGSSVMFRT VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV 

       190        200        210        220        230        240 
VITCVRPGGP ADREGTIKPG DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV 

       250        260        270        280        290        300 
MDSVATASGP LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH 

       310        320        330        340        350        360 
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI QRSDRQHPWD 

       370        380        390        400        410        420 
AWASNQCGVH TNHHHNTYHP DHCRVPALTF PKALPPNSPP AMVPSSSPTS MSAYSLSSLN 

       430        440        450        460        470        480 
MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS LSLASSTVGL AGQVVHTETT EVVLTADPVT 

       490        500        510        520        530        540 
GFGIQLQGSV FATETLSSPP LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN 

       550        560        570        580        590        600 
QLLRDSSITS KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV 

       610        620        630        640        650        660 
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DNCSMEDAVQ ILQQCEDLVK LKIRKDEDNS 

       670        680        690        700        710        720 
DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS LTKGGLAERT GAIHIGDRIL 

       730        740        750        760        770        780 
AINSSSLKGK PLSEAIHLLQ MAGETVTLKI KKQTDAQSAS SPKKFPIPGH SGDLGDGEED 

       790        800        810        820        830        840 
PSPIQKPGKL SDAYPSTVPS VDSAVDSWDG SGIDASYGSQ GSTFQTSGYN YNTYDWRSPK 

       850        860        870        880        890        900 
QRTSLSPVPK PRSQTYPDVG LSNEDWDRST ASGFVGASDS ADAEQEENFW SQALEDLETC 

       910        920        930        940        950        960 
GQSGILRELE EKADRRVSLR NMTLLATIMS GSTMSLNHEA PMARSQLGRQ ASFQERSSSR 

       970        980        990       1000       1010       1020 
PHYSQTTRSN TLPSDVGRKS VTLRKMKQEI KEIMSPTPVE LHKVTLYKDS GMEDFGFSVA 

      1030       1040       1050       1060       1070       1080 
DGLLEKGVYV KNIRPAGPGD VGGLKPYDRL LQVNHVRTRD FDCCLVVPLI AESGNKLDLV 

      1090       1100       1110       1120 
ISRNPLASQK SIEQPALPSD WSEQNSAFFQ QPSHGGNLET REPTNTL 

« Hide

Isoform 2 (GRIP1b) (GRIP1b-S) [UniParc].

Checksum: 91DF2CDD7367028A
Show »

FASTA1,034111,487
Isoform 3 (GRIP1a-S) [UniParc].

Checksum: 82F04408111C9AF2
Show »

FASTA1,033111,383
Isoform 4 [UniParc].

Checksum: 172ACDBA40467E43
Show »

FASTA63268,966

References

« Hide 'large scale' references
[1]"Differential palmitoylation of two mouse glutamate receptor interacting protein 1 forms with different N-terminal sequences."
Yamazaki M., Fukaya M., Abe M., Ikeno K., Kakizaki T., Watanabe M., Sakimura K.
Neurosci. Lett. 304:81-84(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, PALMITOYLATION OF ISOFORM 2.
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Strain: C57BL/6J.
Tissue: Testis.
[3]"PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands."
Torres R., Firestein B.L., Dong H., Staudinger J., Olson E.N., Huganir R.L., Bredt D.S., Gale N.W., Yancopoulos G.D.
Neuron 21:1453-1463(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH EFNB1; EPHA7 AND EPHB2.
[4]"Glutamate-receptor-interacting protein GRIP1 directly steers kinesin to dendrites."
Setou M., Seog D.-H., Tanaka Y., Kanai Y., Takei Y., Kawagishi M., Hirokawa N.
Nature 417:83-87(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH KIF5A; KIF5B AND KIF5C.
[5]"The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling."
Stegmueller J., Werner H., Nave K.-A., Trotter J.
J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CSPG4 AND GRIA2, DOMAIN, TISSUE SPECIFICITY.
[6]"Phospholipase Cdelta4 associates with glutamate receptor interacting protein 1 in testis."
Irino Y., Ichinohe M., Nakamura Y., Nakahara M., Fukami K.
J. Biochem. 138:451-456(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PLCD4.
[7]"GAC63, a GRIP1-dependent nuclear receptor coactivator."
Chen Y.-H., Kim J.H., Stallcup M.R.
Mol. Cell. Biol. 25:5965-5972(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH SLC30A9.
[8]"The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior."
Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L.
Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ATAD1 AND GRIA2.
[9]"Solution structure of the PDZ domain from mouse glutamate receptor interacting protein 1A-L (GRIP1) homolog."
RIKEN structural genomics initiative (RSGI)
Submitted (MAY-2004) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 461-570.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB051560 mRNA. Translation: BAB46929.1.
AB051561 mRNA. Translation: BAB46930.1.
AB051562 mRNA. Translation: BAB46931.1.
AK029905 mRNA. Translation: BAC26668.1.
AK043821 mRNA. Translation: BAC31662.2.
RefSeqNP_001264221.1. NM_001277292.1.
NP_001264223.1. NM_001277294.1.
NP_001264224.1. NM_001277295.1.
NP_083012.1. NM_028736.2.
NP_570961.1. NM_130891.2.
NP_597699.1. NM_133442.2.
UniGeneMm.196692.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1V5QNMR-A461-569[»]
ProteinModelPortalQ925T6.
SMRQ925T6. Positions 48-343, 463-753, 995-1085.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid216454. 6 interactions.
IntActQ925T6. 13 interactions.
MINTMINT-1787557.

PTM databases

PhosphoSiteQ925T6.

Proteomic databases

PaxDbQ925T6.
PRIDEQ925T6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813. [Q925T6-2]
ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813. [Q925T6-4]
ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813. [Q925T6-1]
ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813. [Q925T6-3]
GeneID74053.
KEGGmmu:74053.
UCSCuc007heg.1. mouse. [Q925T6-2]
uc007hek.1. mouse. [Q925T6-1]
uc007hel.1. mouse. [Q925T6-3]
uc007hep.1. mouse. [Q925T6-4]

Organism-specific databases

CTD23426.
MGIMGI:1921303. Grip1.

Phylogenomic databases

eggNOGNOG297474.
GeneTreeENSGT00390000013494.
HOGENOMHOG000043120.
HOVERGENHBG051841.
InParanoidQ925T6.
OMAKKQTDAQ.
PhylomeDBQ925T6.
TreeFamTF326909.

Gene expression databases

BgeeQ925T6.
CleanExMM_GRIP1.
GenevestigatorQ925T6.

Family and domain databases

Gene3D2.30.42.10. 7 hits.
InterProIPR001478. PDZ.
[Graphical view]
PfamPF00595. PDZ. 7 hits.
[Graphical view]
SMARTSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMSSF50156. SSF50156. 7 hits.
PROSITEPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSGRIP1. mouse.
EvolutionaryTraceQ925T6.
NextBio339644.
PROQ925T6.
SOURCESearch...

Entry information

Entry nameGRIP1_MOUSE
AccessionPrimary (citable) accession number: Q925T6
Secondary accession number(s): Q8BLQ3 expand/collapse secondary AC list , Q8C0T3, Q925T5, Q925T7
Entry history
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot