Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q925Q8

- DACH2_MOUSE

UniProt

Q925Q8 - DACH2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dachshund homolog 2

Gene

Dach2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Is recruited with SIX6 to the p27Kip1 promoter in embryonal retina. SIX6 corepression seems also to involve NCOR1, TBL1, HDAC1 and HDAC3. May be involved together with PAX3, SIX1, and EYA2 in regulation of myogenesis. In the developing somite, expression of DACH2 and PAX3 is regulated by the overlying ectoderm, and DACH2 and PAX3 positively regulate each other's expression. Probably binds to DNA via its DACHbox-N domain.2 Publications

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. development of primary female sexual characteristics Source: MGI
  2. regulation of transcription, DNA-templated Source: UniProtKB-KW
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dachshund homolog 2
Short name:
Dach2
Gene namesi
Name:Dach2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:1890446. Dach2.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 634634Dachshund homolog 2PRO_0000095600Add
BLAST

Proteomic databases

MaxQBiQ925Q8.
PRIDEiQ925Q8.

PTM databases

PhosphoSiteiQ925Q8.

Expressioni

Tissue specificityi

Expressed in embryo, and at lower levels in the newborn.1 Publication

Developmental stagei

From 8.5 to 14.5 dpc detected in nervous tissue. In the brain detected at 8.5 dpc within the prospective hindbrain, but not within the developing forebrain or midbrain. At 9.5 dpc expressed within the ventral prosencephalon, hindbrain and forebrain. Expression within the forebrain neuroectoderm flanked the optic vesicle with rostral and caudal restrictions. In addition, dorsal and ventral expression domains were observed within the hindbrain. At 10.5 to 12.5 dpc detected in the dorsal mesencephalon, in addition to the telencephalon and hindbrain. At 14.5 dpc visible in the olfactory bulbs. Detected from 9.5 to 12.5 dpc in the dorsal neural tube with the highest expression near the hindbrain. At 9.5 and 10.5 dpc detected in cells located in the dorsal and ventral neural tube and dorsal root ganglia. Detected during the development of the optic and the auditory systems. At 10.5 dpc, a small ring of ocular staining was observed suggesting expression in the lens pit. At 10.5 dpc expressed in the developing lens epithelium and in the mesenchyme surrounding the retina. However, expression in the lens placode ectoderm was not detected, suggesting that DACH2 is activated after lens vesicle formation. Low levels of expression could also be detected in the peripheral neuroretina at 10.5 and 12.5 dpc. Detected in the otic pit at 9.5 dpc and in the otic endolymphatic duct at 10.5, 11.5 and 12.5 dpc. From 10.5 to 14.5 dpc detected in the developing fore and hind limbs. At 10.5 and 11.5 dpc observed in the anterior and posterior margins and presumptive hand plate of the limb bud. At 9.5 and 10.5 dpc expressed in the limb. At 12.5 dpc is detected in the hand plate with strong expression at the margins of the limb plate. At 14.5 dpc detected in the hand plate and lateral edges of the digits. At 8.5 dpc expression was not detected in the developing somites. In contrast, from 9.5 to 12.5 dpc, expression is detected in a repeated pattern located lateral to the neural tube and in the interlimb bud region suggesting expression in somite derivatives. At 9.5 dpc detected in the forelimb dermamyotome. Also located along the lateral portion of the trunk and within a dorsal domain within the limb bud. At 10.5 dpc expressed in lateral and limb mesoderm. From 9.5 to 10.5 dpc detected in head mesenchyme and the branchial arches. At 9.5 and 10 dpc. expressed in the head mesoderm associated with the developing eye. At 10.5 dpc this pattern appears as a ring of expression surrounding the eye. At 11.5 dpc expression is still detectable in the branchial arches with strong expression at the cranial sinus. At 14.5 dpc mammary gland primordia. Detected in the nasal openings and vibrissae.1 Publication

Gene expression databases

BgeeiQ925Q8.
CleanExiMM_DACH2.
ExpressionAtlasiQ925Q8. baseline and differential.
GenevestigatoriQ925Q8.

Interactioni

Subunit structurei

Interacts with SIX6. Interacts with EYA2 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ925Q8. 1 interaction.
STRINGi10090.ENSMUSP00000064393.

Structurei

3D structure databases

ProteinModelPortaliQ925Q8.
SMRiQ925Q8. Positions 73-169.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni76 – 16287DACHbox-NAdd
BLAST
Regioni488 – 56881DACHbox-CAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili494 – 58895Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi357 – 3604Poly-Ala

Domaini

The DACHbox-N domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.By similarity

Sequence similaritiesi

Belongs to the DACH/dachshund family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG279124.
GeneTreeiENSGT00390000001134.
HOGENOMiHOG000293309.
HOVERGENiHBG065810.
InParanoidiQ925Q8.
OMAiDCTNARR.
OrthoDBiEOG7ZKSCN.
PhylomeDBiQ925Q8.
TreeFamiTF316697.

Family and domain databases

Gene3Di3.10.260.20. 1 hit.
InterProiIPR009061. DNA-bd_dom_put.
IPR003380. Transform_Ski.
[Graphical view]
PfamiPF02437. Ski_Sno. 1 hit.
[Graphical view]
SUPFAMiSSF46955. SSF46955. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q925Q8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVSAPPVIS ATSSSAGVPG GLFRAEPLYS SPGEPPRLTP NMINSFMANN
60 70 80 90 100
HNGSVLGGGI GGGSGGSSNT NTNECRMVDM HGVKVASFLM DGQELICLPQ
110 120 130 140 150
VFDLFLKHLV GGLHTVYTKL KRLDISPVVC TVEQVRILRG LGAIQPGVNR
160 170 180 190 200
CKLITRKDFE TLFTDCTNAR RKRQMTRKQA VNSSRPGRPP KRSLGVLQDN
210 220 230 240 250
ARLLPHAVPG LLSPGLITPT GITAAAMAEA MKLQKMKLMA MNTLQGNGSQ
260 270 280 290 300
NGTESEPDDL NSTTGGSESS WDKDKIQSPL AASGPQHGIA HAALAGQPGL
310 320 330 340 350
GGAPTLNPLQ QNHLLSNRLD LPFMMMPHPL LPVSLPPASV AMAMNQMNHL
360 370 380 390 400
NTIANMAAAA QIHSPLSRAG ASVIKERIPE SPSPAPSLEE SHRPGSQTSS
410 420 430 440 450
HPSSSVSSSP SQMDHHSERM VMMPNNREEL IVDQDNGQSI KKFQRDNKEE
460 470 480 490 500
VPAQIPVMKS PLDKIQLAPG QALHPGFPGP FIFADSLSSV ETLLTNIQGL
510 520 530 540 550
LKVALDNARI QEKQIQQEKK ELRIELFRER EIRENLERQL AVELQSRSTM
560 570 580 590 600
QKRLKKEKKA KRKLQEALEF ESKRREQVEQ ALKQATSGDS GLRMLKDSGI
610 620 630
PDIEIENSGT PHDSAAMQGG NYYCLAMAQQ LCSA
Length:634
Mass (Da):68,588
Last modified:December 1, 2001 - v1
Checksum:i838A491FFF20C410
GO
Isoform 2 (identifier: Q925Q8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-182: Missing.
     619-634: GGNYYCLAMAQQLCSA → A

Show »
Length:606
Mass (Da):65,331
Checksum:i0561FF999603AA3E
GO
Isoform 3 (identifier: Q925Q8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: Missing.
     449-449: E → DIQLSQHHLLNTFLHWIELAPLSKKSLHHQK
     498-498: Q → QVNNISINKIN

Note: No experimental confirmation available.

Show »
Length:500
Mass (Da):54,698
Checksum:i07A15FBB5660B6B9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti507 – 5071N → D in BAC28138. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 174174Missing in isoform 3. 1 PublicationVSP_009495Add
BLAST
Alternative sequencei170 – 18213Missing in isoform 2. 1 PublicationVSP_009493Add
BLAST
Alternative sequencei449 – 4491E → DIQLSQHHLLNTFLHWIELA PLSKKSLHHQK in isoform 3. 1 PublicationVSP_009496
Alternative sequencei498 – 4981Q → QVNNISINKIN in isoform 3. 1 PublicationVSP_009497
Alternative sequencei619 – 63416GGNYY…QLCSA → A in isoform 2. 1 PublicationVSP_009494Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF257217 mRNA. Translation: AAK39983.1.
AK033050 mRNA. Translation: BAC28138.1.
BC059233 mRNA. Translation: AAH59233.1.
CCDSiCCDS30363.1. [Q925Q8-1]
CCDS53175.1. [Q925Q8-2]
RefSeqiNP_001136042.1. NM_001142570.1. [Q925Q8-2]
NP_001276661.1. NM_001289732.1. [Q925Q8-3]
NP_001276662.1. NM_001289733.1.
NP_001276663.1. NM_001289734.1.
NP_291083.1. NM_033605.2. [Q925Q8-1]
UniGeneiMm.79760.

Genome annotation databases

EnsembliENSMUST00000067219; ENSMUSP00000064393; ENSMUSG00000025592. [Q925Q8-1]
ENSMUST00000113380; ENSMUSP00000109007; ENSMUSG00000025592. [Q925Q8-3]
ENSMUST00000113382; ENSMUSP00000109009; ENSMUSG00000025592. [Q925Q8-2]
GeneIDi93837.
KEGGimmu:93837.
UCSCiuc009uds.1. mouse. [Q925Q8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF257217 mRNA. Translation: AAK39983.1 .
AK033050 mRNA. Translation: BAC28138.1 .
BC059233 mRNA. Translation: AAH59233.1 .
CCDSi CCDS30363.1. [Q925Q8-1 ]
CCDS53175.1. [Q925Q8-2 ]
RefSeqi NP_001136042.1. NM_001142570.1. [Q925Q8-2 ]
NP_001276661.1. NM_001289732.1. [Q925Q8-3 ]
NP_001276662.1. NM_001289733.1.
NP_001276663.1. NM_001289734.1.
NP_291083.1. NM_033605.2. [Q925Q8-1 ]
UniGenei Mm.79760.

3D structure databases

ProteinModelPortali Q925Q8.
SMRi Q925Q8. Positions 73-169.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q925Q8. 1 interaction.
STRINGi 10090.ENSMUSP00000064393.

PTM databases

PhosphoSitei Q925Q8.

Proteomic databases

MaxQBi Q925Q8.
PRIDEi Q925Q8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000067219 ; ENSMUSP00000064393 ; ENSMUSG00000025592 . [Q925Q8-1 ]
ENSMUST00000113380 ; ENSMUSP00000109007 ; ENSMUSG00000025592 . [Q925Q8-3 ]
ENSMUST00000113382 ; ENSMUSP00000109009 ; ENSMUSG00000025592 . [Q925Q8-2 ]
GeneIDi 93837.
KEGGi mmu:93837.
UCSCi uc009uds.1. mouse. [Q925Q8-1 ]

Organism-specific databases

CTDi 117154.
MGIi MGI:1890446. Dach2.

Phylogenomic databases

eggNOGi NOG279124.
GeneTreei ENSGT00390000001134.
HOGENOMi HOG000293309.
HOVERGENi HBG065810.
InParanoidi Q925Q8.
OMAi DCTNARR.
OrthoDBi EOG7ZKSCN.
PhylomeDBi Q925Q8.
TreeFami TF316697.

Miscellaneous databases

ChiTaRSi DACH2. mouse.
NextBioi 351689.
PROi Q925Q8.
SOURCEi Search...

Gene expression databases

Bgeei Q925Q8.
CleanExi MM_DACH2.
ExpressionAtlasi Q925Q8. baseline and differential.
Genevestigatori Q925Q8.

Family and domain databases

Gene3Di 3.10.260.20. 1 hit.
InterProi IPR009061. DNA-bd_dom_put.
IPR003380. Transform_Ski.
[Graphical view ]
Pfami PF02437. Ski_Sno. 1 hit.
[Graphical view ]
SUPFAMi SSF46955. SSF46955. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of mouse Dach2, a homologue of Drosophila dachshund."
    Davis R.J., Shen W., Sandler Y.I., Heanue T.A., Mardon G.
    Mech. Dev. 102:169-179(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: Swiss Webster / NIH.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Eye.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Brain.
  4. "Tissue-specific regulation of retinal and pituitary precursor cell proliferation."
    Li X., Perissi V., Liu F., Rose D.W., Rosenfeld M.G.
    Science 297:1180-1183(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SIX6.
  5. "Pax3 and Dach2 positive regulation in the developing somite."
    Kardon G., Heanue T.A., Tabin C.J.
    Dev. Dyn. 224:350-355(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiDACH2_MOUSE
AccessioniPrimary (citable) accession number: Q925Q8
Secondary accession number(s): Q8BMA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3