Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q925Q8 (DACH2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dachshund homolog 2

Short name=Dach2
Gene names
Name:Dach2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length634 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Is recruited with SIX6 to the p27Kip1 promoter in embryonal retina. SIX6 corepression seems also to involve NCOR1, TBL1, HDAC1 and HDAC3. May be involved together with PAX3, SIX1, and EYA2 in regulation of myogenesis. In the developing somite, expression of DACH2 and PAX3 is regulated by the overlying ectoderm, and DACH2 and PAX3 positively regulate each other's expression. Probably binds to DNA via its DACHbox-N domain. Ref.4 Ref.5

Subunit structure

Interacts with SIX6. Interacts with EYA2 By similarity. Ref.4

Subcellular location

Nucleus Probable.

Tissue specificity

Expressed in embryo, and at lower levels in the newborn. Ref.1

Developmental stage

From 8.5 to 14.5 dpc detected in nervous tissue. In the brain detected at 8.5 dpc within the prospective hindbrain, but not within the developing forebrain or midbrain. At 9.5 dpc expressed within the ventral prosencephalon, hindbrain and forebrain. Expression within the forebrain neuroectoderm flanked the optic vesicle with rostral and caudal restrictions. In addition, dorsal and ventral expression domains were observed within the hindbrain. At 10.5 to 12.5 dpc detected in the dorsal mesencephalon, in addition to the telencephalon and hindbrain. At 14.5 dpc visible in the olfactory bulbs. Detected from 9.5 to 12.5 dpc in the dorsal neural tube with the highest expression near the hindbrain. At 9.5 and 10.5 dpc detected in cells located in the dorsal and ventral neural tube and dorsal root ganglia. Detected during the development of the optic and the auditory systems. At 10.5 dpc, a small ring of ocular staining was observed suggesting expression in the lens pit. At 10.5 dpc expressed in the developing lens epithelium and in the mesenchyme surrounding the retina. However, expression in the lens placode ectoderm was not detected, suggesting that DACH2 is activated after lens vesicle formation. Low levels of expression could also be detected in the peripheral neuroretina at 10.5 and 12.5 dpc. Detected in the otic pit at 9.5 dpc and in the otic endolymphatic duct at 10.5, 11.5 and 12.5 dpc. From 10.5 to 14.5 dpc detected in the developing fore and hind limbs. At 10.5 and 11.5 dpc observed in the anterior and posterior margins and presumptive hand plate of the limb bud. At 9.5 and 10.5 dpc expressed in the limb. At 12.5 dpc is detected in the hand plate with strong expression at the margins of the limb plate. At 14.5 dpc detected in the hand plate and lateral edges of the digits. At 8.5 dpc expression was not detected in the developing somites. In contrast, from 9.5 to 12.5 dpc, expression is detected in a repeated pattern located lateral to the neural tube and in the interlimb bud region suggesting expression in somite derivatives. At 9.5 dpc detected in the forelimb dermamyotome. Also located along the lateral portion of the trunk and within a dorsal domain within the limb bud. At 10.5 dpc expressed in lateral and limb mesoderm. From 9.5 to 10.5 dpc detected in head mesenchyme and the branchial arches. At 9.5 and 10 dpc. expressed in the head mesoderm associated with the developing eye. At 10.5 dpc this pattern appears as a ring of expression surrounding the eye. At 11.5 dpc expression is still detectable in the branchial arches with strong expression at the cranial sinus. At 14.5 dpc mammary gland primordia. Detected in the nasal openings and vibrissae. Ref.1

Domain

The DACHbox-N domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain By similarity.

Sequence similarities

Belongs to the DACH/dachshund family.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   LigandDNA-binding
   Molecular functionDevelopmental protein
Repressor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdevelopment of primary female sexual characteristics

Inferred from genetic interaction PubMed 18395837. Source: MGI

regulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q925Q8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q925Q8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     170-182: Missing.
     619-634: GGNYYCLAMAQQLCSA → A
Isoform 3 (identifier: Q925Q8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: Missing.
     449-449: E → DIQLSQHHLLNTFLHWIELAPLSKKSLHHQK
     498-498: Q → QVNNISINKIN
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 634634Dachshund homolog 2
PRO_0000095600

Regions

Region76 – 16287DACHbox-N
Region488 – 56881DACHbox-C
Coiled coil494 – 58895 Potential
Compositional bias357 – 3604Poly-Ala

Natural variations

Alternative sequence1 – 174174Missing in isoform 3.
VSP_009495
Alternative sequence170 – 18213Missing in isoform 2.
VSP_009493
Alternative sequence4491E → DIQLSQHHLLNTFLHWIELA PLSKKSLHHQK in isoform 3.
VSP_009496
Alternative sequence4981Q → QVNNISINKIN in isoform 3.
VSP_009497
Alternative sequence619 – 63416GGNYY…QLCSA → A in isoform 2.
VSP_009494

Experimental info

Sequence conflict5071N → D in BAC28138. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 838A491FFF20C410

FASTA63468,588
        10         20         30         40         50         60 
MAVSAPPVIS ATSSSAGVPG GLFRAEPLYS SPGEPPRLTP NMINSFMANN HNGSVLGGGI 

        70         80         90        100        110        120 
GGGSGGSSNT NTNECRMVDM HGVKVASFLM DGQELICLPQ VFDLFLKHLV GGLHTVYTKL 

       130        140        150        160        170        180 
KRLDISPVVC TVEQVRILRG LGAIQPGVNR CKLITRKDFE TLFTDCTNAR RKRQMTRKQA 

       190        200        210        220        230        240 
VNSSRPGRPP KRSLGVLQDN ARLLPHAVPG LLSPGLITPT GITAAAMAEA MKLQKMKLMA 

       250        260        270        280        290        300 
MNTLQGNGSQ NGTESEPDDL NSTTGGSESS WDKDKIQSPL AASGPQHGIA HAALAGQPGL 

       310        320        330        340        350        360 
GGAPTLNPLQ QNHLLSNRLD LPFMMMPHPL LPVSLPPASV AMAMNQMNHL NTIANMAAAA 

       370        380        390        400        410        420 
QIHSPLSRAG ASVIKERIPE SPSPAPSLEE SHRPGSQTSS HPSSSVSSSP SQMDHHSERM 

       430        440        450        460        470        480 
VMMPNNREEL IVDQDNGQSI KKFQRDNKEE VPAQIPVMKS PLDKIQLAPG QALHPGFPGP 

       490        500        510        520        530        540 
FIFADSLSSV ETLLTNIQGL LKVALDNARI QEKQIQQEKK ELRIELFRER EIRENLERQL 

       550        560        570        580        590        600 
AVELQSRSTM QKRLKKEKKA KRKLQEALEF ESKRREQVEQ ALKQATSGDS GLRMLKDSGI 

       610        620        630 
PDIEIENSGT PHDSAAMQGG NYYCLAMAQQ LCSA 

« Hide

Isoform 2 [UniParc].

Checksum: 0561FF999603AA3E
Show »

FASTA60665,331
Isoform 3 [UniParc].

Checksum: 07A15FBB5660B6B9
Show »

FASTA50054,698

References

« Hide 'large scale' references
[1]"Characterization of mouse Dach2, a homologue of Drosophila dachshund."
Davis R.J., Shen W., Sandler Y.I., Heanue T.A., Mardon G.
Mech. Dev. 102:169-179(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: Swiss Webster / NIH.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Strain: C57BL/6J.
Tissue: Eye.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Brain.
[4]"Tissue-specific regulation of retinal and pituitary precursor cell proliferation."
Li X., Perissi V., Liu F., Rose D.W., Rosenfeld M.G.
Science 297:1180-1183(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH SIX6.
[5]"Pax3 and Dach2 positive regulation in the developing somite."
Kardon G., Heanue T.A., Tabin C.J.
Dev. Dyn. 224:350-355(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF257217 mRNA. Translation: AAK39983.1.
AK033050 mRNA. Translation: BAC28138.1.
BC059233 mRNA. Translation: AAH59233.1.
CCDSCCDS30363.1. [Q925Q8-1]
CCDS53175.1. [Q925Q8-2]
RefSeqNP_001136042.1. NM_001142570.1. [Q925Q8-2]
NP_001276661.1. NM_001289732.1. [Q925Q8-3]
NP_001276662.1. NM_001289733.1.
NP_001276663.1. NM_001289734.1.
NP_291083.1. NM_033605.2. [Q925Q8-1]
UniGeneMm.79760.

3D structure databases

ProteinModelPortalQ925Q8.
SMRQ925Q8. Positions 73-169.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ925Q8. 1 interaction.
STRING10090.ENSMUSP00000064393.

PTM databases

PhosphoSiteQ925Q8.

Proteomic databases

PRIDEQ925Q8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000067219; ENSMUSP00000064393; ENSMUSG00000025592. [Q925Q8-1]
ENSMUST00000113380; ENSMUSP00000109007; ENSMUSG00000025592. [Q925Q8-3]
ENSMUST00000113382; ENSMUSP00000109009; ENSMUSG00000025592. [Q925Q8-2]
GeneID93837.
KEGGmmu:93837.
UCSCuc009uds.1. mouse. [Q925Q8-1]

Organism-specific databases

CTD117154.
MGIMGI:1890446. Dach2.

Phylogenomic databases

eggNOGNOG279124.
GeneTreeENSGT00390000001134.
HOGENOMHOG000293309.
HOVERGENHBG065810.
InParanoidQ925Q8.
OMADCTNARR.
OrthoDBEOG7ZKSCN.
PhylomeDBQ925Q8.
TreeFamTF316697.

Gene expression databases

BgeeQ925Q8.
CleanExMM_DACH2.
GenevestigatorQ925Q8.

Family and domain databases

Gene3D3.10.260.20. 1 hit.
InterProIPR009061. DNA-bd_dom_put.
IPR003380. Transform_Ski.
[Graphical view]
PfamPF02437. Ski_Sno. 1 hit.
[Graphical view]
SUPFAMSSF46955. SSF46955. 1 hit.
ProtoNetSearch...

Other

ChiTaRSDACH2. mouse.
NextBio351689.
PROQ925Q8.
SOURCESearch...

Entry information

Entry nameDACH2_MOUSE
AccessionPrimary (citable) accession number: Q925Q8
Secondary accession number(s): Q8BMA0
Entry history
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot