Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q925Q8

- DACH2_MOUSE

UniProt

Q925Q8 - DACH2_MOUSE

Protein

Dachshund homolog 2

Gene

Dach2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Is recruited with SIX6 to the p27Kip1 promoter in embryonal retina. SIX6 corepression seems also to involve NCOR1, TBL1, HDAC1 and HDAC3. May be involved together with PAX3, SIX1, and EYA2 in regulation of myogenesis. In the developing somite, expression of DACH2 and PAX3 is regulated by the overlying ectoderm, and DACH2 and PAX3 positively regulate each other's expression. Probably binds to DNA via its DACHbox-N domain.2 Publications

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. development of primary female sexual characteristics Source: MGI
    2. regulation of transcription, DNA-templated Source: UniProtKB-KW
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dachshund homolog 2
    Short name:
    Dach2
    Gene namesi
    Name:Dach2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:1890446. Dach2.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 634634Dachshund homolog 2PRO_0000095600Add
    BLAST

    Proteomic databases

    PRIDEiQ925Q8.

    PTM databases

    PhosphoSiteiQ925Q8.

    Expressioni

    Tissue specificityi

    Expressed in embryo, and at lower levels in the newborn.1 Publication

    Developmental stagei

    From 8.5 to 14.5 dpc detected in nervous tissue. In the brain detected at 8.5 dpc within the prospective hindbrain, but not within the developing forebrain or midbrain. At 9.5 dpc expressed within the ventral prosencephalon, hindbrain and forebrain. Expression within the forebrain neuroectoderm flanked the optic vesicle with rostral and caudal restrictions. In addition, dorsal and ventral expression domains were observed within the hindbrain. At 10.5 to 12.5 dpc detected in the dorsal mesencephalon, in addition to the telencephalon and hindbrain. At 14.5 dpc visible in the olfactory bulbs. Detected from 9.5 to 12.5 dpc in the dorsal neural tube with the highest expression near the hindbrain. At 9.5 and 10.5 dpc detected in cells located in the dorsal and ventral neural tube and dorsal root ganglia. Detected during the development of the optic and the auditory systems. At 10.5 dpc, a small ring of ocular staining was observed suggesting expression in the lens pit. At 10.5 dpc expressed in the developing lens epithelium and in the mesenchyme surrounding the retina. However, expression in the lens placode ectoderm was not detected, suggesting that DACH2 is activated after lens vesicle formation. Low levels of expression could also be detected in the peripheral neuroretina at 10.5 and 12.5 dpc. Detected in the otic pit at 9.5 dpc and in the otic endolymphatic duct at 10.5, 11.5 and 12.5 dpc. From 10.5 to 14.5 dpc detected in the developing fore and hind limbs. At 10.5 and 11.5 dpc observed in the anterior and posterior margins and presumptive hand plate of the limb bud. At 9.5 and 10.5 dpc expressed in the limb. At 12.5 dpc is detected in the hand plate with strong expression at the margins of the limb plate. At 14.5 dpc detected in the hand plate and lateral edges of the digits. At 8.5 dpc expression was not detected in the developing somites. In contrast, from 9.5 to 12.5 dpc, expression is detected in a repeated pattern located lateral to the neural tube and in the interlimb bud region suggesting expression in somite derivatives. At 9.5 dpc detected in the forelimb dermamyotome. Also located along the lateral portion of the trunk and within a dorsal domain within the limb bud. At 10.5 dpc expressed in lateral and limb mesoderm. From 9.5 to 10.5 dpc detected in head mesenchyme and the branchial arches. At 9.5 and 10 dpc. expressed in the head mesoderm associated with the developing eye. At 10.5 dpc this pattern appears as a ring of expression surrounding the eye. At 11.5 dpc expression is still detectable in the branchial arches with strong expression at the cranial sinus. At 14.5 dpc mammary gland primordia. Detected in the nasal openings and vibrissae.1 Publication

    Gene expression databases

    BgeeiQ925Q8.
    CleanExiMM_DACH2.
    GenevestigatoriQ925Q8.

    Interactioni

    Subunit structurei

    Interacts with SIX6. Interacts with EYA2 By similarity.By similarity

    Protein-protein interaction databases

    IntActiQ925Q8. 1 interaction.
    STRINGi10090.ENSMUSP00000064393.

    Structurei

    3D structure databases

    ProteinModelPortaliQ925Q8.
    SMRiQ925Q8. Positions 73-169.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni76 – 16287DACHbox-NAdd
    BLAST
    Regioni488 – 56881DACHbox-CAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili494 – 58895Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi357 – 3604Poly-Ala

    Domaini

    The DACHbox-N domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.By similarity

    Sequence similaritiesi

    Belongs to the DACH/dachshund family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG279124.
    GeneTreeiENSGT00390000001134.
    HOGENOMiHOG000293309.
    HOVERGENiHBG065810.
    InParanoidiQ925Q8.
    OMAiDCTNARR.
    OrthoDBiEOG7ZKSCN.
    PhylomeDBiQ925Q8.
    TreeFamiTF316697.

    Family and domain databases

    Gene3Di3.10.260.20. 1 hit.
    InterProiIPR009061. DNA-bd_dom_put.
    IPR003380. Transform_Ski.
    [Graphical view]
    PfamiPF02437. Ski_Sno. 1 hit.
    [Graphical view]
    SUPFAMiSSF46955. SSF46955. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q925Q8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAVSAPPVIS ATSSSAGVPG GLFRAEPLYS SPGEPPRLTP NMINSFMANN    50
    HNGSVLGGGI GGGSGGSSNT NTNECRMVDM HGVKVASFLM DGQELICLPQ 100
    VFDLFLKHLV GGLHTVYTKL KRLDISPVVC TVEQVRILRG LGAIQPGVNR 150
    CKLITRKDFE TLFTDCTNAR RKRQMTRKQA VNSSRPGRPP KRSLGVLQDN 200
    ARLLPHAVPG LLSPGLITPT GITAAAMAEA MKLQKMKLMA MNTLQGNGSQ 250
    NGTESEPDDL NSTTGGSESS WDKDKIQSPL AASGPQHGIA HAALAGQPGL 300
    GGAPTLNPLQ QNHLLSNRLD LPFMMMPHPL LPVSLPPASV AMAMNQMNHL 350
    NTIANMAAAA QIHSPLSRAG ASVIKERIPE SPSPAPSLEE SHRPGSQTSS 400
    HPSSSVSSSP SQMDHHSERM VMMPNNREEL IVDQDNGQSI KKFQRDNKEE 450
    VPAQIPVMKS PLDKIQLAPG QALHPGFPGP FIFADSLSSV ETLLTNIQGL 500
    LKVALDNARI QEKQIQQEKK ELRIELFRER EIRENLERQL AVELQSRSTM 550
    QKRLKKEKKA KRKLQEALEF ESKRREQVEQ ALKQATSGDS GLRMLKDSGI 600
    PDIEIENSGT PHDSAAMQGG NYYCLAMAQQ LCSA 634
    Length:634
    Mass (Da):68,588
    Last modified:December 1, 2001 - v1
    Checksum:i838A491FFF20C410
    GO
    Isoform 2 (identifier: Q925Q8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         170-182: Missing.
         619-634: GGNYYCLAMAQQLCSA → A

    Show »
    Length:606
    Mass (Da):65,331
    Checksum:i0561FF999603AA3E
    GO
    Isoform 3 (identifier: Q925Q8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-174: Missing.
         449-449: E → DIQLSQHHLLNTFLHWIELAPLSKKSLHHQK
         498-498: Q → QVNNISINKIN

    Note: No experimental confirmation available.

    Show »
    Length:500
    Mass (Da):54,698
    Checksum:i07A15FBB5660B6B9
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti507 – 5071N → D in BAC28138. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 174174Missing in isoform 3. 1 PublicationVSP_009495Add
    BLAST
    Alternative sequencei170 – 18213Missing in isoform 2. 1 PublicationVSP_009493Add
    BLAST
    Alternative sequencei449 – 4491E → DIQLSQHHLLNTFLHWIELA PLSKKSLHHQK in isoform 3. 1 PublicationVSP_009496
    Alternative sequencei498 – 4981Q → QVNNISINKIN in isoform 3. 1 PublicationVSP_009497
    Alternative sequencei619 – 63416GGNYY…QLCSA → A in isoform 2. 1 PublicationVSP_009494Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF257217 mRNA. Translation: AAK39983.1.
    AK033050 mRNA. Translation: BAC28138.1.
    BC059233 mRNA. Translation: AAH59233.1.
    CCDSiCCDS30363.1. [Q925Q8-1]
    CCDS53175.1. [Q925Q8-2]
    RefSeqiNP_001136042.1. NM_001142570.1. [Q925Q8-2]
    NP_001276661.1. NM_001289732.1. [Q925Q8-3]
    NP_001276662.1. NM_001289733.1.
    NP_001276663.1. NM_001289734.1.
    NP_291083.1. NM_033605.2. [Q925Q8-1]
    UniGeneiMm.79760.

    Genome annotation databases

    EnsembliENSMUST00000067219; ENSMUSP00000064393; ENSMUSG00000025592. [Q925Q8-1]
    ENSMUST00000113380; ENSMUSP00000109007; ENSMUSG00000025592. [Q925Q8-3]
    ENSMUST00000113382; ENSMUSP00000109009; ENSMUSG00000025592. [Q925Q8-2]
    GeneIDi93837.
    KEGGimmu:93837.
    UCSCiuc009uds.1. mouse. [Q925Q8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF257217 mRNA. Translation: AAK39983.1 .
    AK033050 mRNA. Translation: BAC28138.1 .
    BC059233 mRNA. Translation: AAH59233.1 .
    CCDSi CCDS30363.1. [Q925Q8-1 ]
    CCDS53175.1. [Q925Q8-2 ]
    RefSeqi NP_001136042.1. NM_001142570.1. [Q925Q8-2 ]
    NP_001276661.1. NM_001289732.1. [Q925Q8-3 ]
    NP_001276662.1. NM_001289733.1.
    NP_001276663.1. NM_001289734.1.
    NP_291083.1. NM_033605.2. [Q925Q8-1 ]
    UniGenei Mm.79760.

    3D structure databases

    ProteinModelPortali Q925Q8.
    SMRi Q925Q8. Positions 73-169.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q925Q8. 1 interaction.
    STRINGi 10090.ENSMUSP00000064393.

    PTM databases

    PhosphoSitei Q925Q8.

    Proteomic databases

    PRIDEi Q925Q8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000067219 ; ENSMUSP00000064393 ; ENSMUSG00000025592 . [Q925Q8-1 ]
    ENSMUST00000113380 ; ENSMUSP00000109007 ; ENSMUSG00000025592 . [Q925Q8-3 ]
    ENSMUST00000113382 ; ENSMUSP00000109009 ; ENSMUSG00000025592 . [Q925Q8-2 ]
    GeneIDi 93837.
    KEGGi mmu:93837.
    UCSCi uc009uds.1. mouse. [Q925Q8-1 ]

    Organism-specific databases

    CTDi 117154.
    MGIi MGI:1890446. Dach2.

    Phylogenomic databases

    eggNOGi NOG279124.
    GeneTreei ENSGT00390000001134.
    HOGENOMi HOG000293309.
    HOVERGENi HBG065810.
    InParanoidi Q925Q8.
    OMAi DCTNARR.
    OrthoDBi EOG7ZKSCN.
    PhylomeDBi Q925Q8.
    TreeFami TF316697.

    Miscellaneous databases

    ChiTaRSi DACH2. mouse.
    NextBioi 351689.
    PROi Q925Q8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q925Q8.
    CleanExi MM_DACH2.
    Genevestigatori Q925Q8.

    Family and domain databases

    Gene3Di 3.10.260.20. 1 hit.
    InterProi IPR009061. DNA-bd_dom_put.
    IPR003380. Transform_Ski.
    [Graphical view ]
    Pfami PF02437. Ski_Sno. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46955. SSF46955. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of mouse Dach2, a homologue of Drosophila dachshund."
      Davis R.J., Shen W., Sandler Y.I., Heanue T.A., Mardon G.
      Mech. Dev. 102:169-179(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: Swiss Webster / NIH.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Eye.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Brain.
    4. "Tissue-specific regulation of retinal and pituitary precursor cell proliferation."
      Li X., Perissi V., Liu F., Rose D.W., Rosenfeld M.G.
      Science 297:1180-1183(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH SIX6.
    5. "Pax3 and Dach2 positive regulation in the developing somite."
      Kardon G., Heanue T.A., Tabin C.J.
      Dev. Dyn. 224:350-355(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiDACH2_MOUSE
    AccessioniPrimary (citable) accession number: Q925Q8
    Secondary accession number(s): Q8BMA0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 2004
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3