Q925Q8 (DACH2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dachshund homolog 2 Short name=Dach2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 634 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Is recruited with SIX6 to the p27Kip1 promoter in embryonal retina. SIX6 corepression seems also to involve NCOR1, TBL1, HDAC1 and HDAC3. May be involved together with PAX3, SIX1, and EYA2 in regulation of myogenesis. In the developing somite, expression of DACH2 and PAX3 is regulated by the overlying ectoderm, and DACH2 and PAX3 positively regulate each other's expression. Probably binds to DNA via its DACHbox-N domain. Ref.4 Ref.5 |
| Subunit structure | Interacts with SIX6. Interacts with EYA2 By similarity. Ref.4 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in embryo, and at lower levels in the newborn. Ref.1 |
| Developmental stage | From 8.5 to 14.5 dpc detected in nervous tissue. In the brain detected at 8.5 dpc within the prospective hindbrain, but not within the developing forebrain or midbrain. At 9.5 dpc expressed within the ventral prosencephalon, hindbrain and forebrain. Expression within the forebrain neuroectoderm flanked the optic vesicle with rostral and caudal restrictions. In addition, dorsal and ventral expression domains were observed within the hindbrain. At 10.5 to 12.5 dpc detected in the dorsal mesencephalon, in addition to the telencephalon and hindbrain. At 14.5 dpc visible in the olfactory bulbs. Detected from 9.5 to 12.5 dpc in the dorsal neural tube with the highest expression near the hindbrain. At 9.5 and 10.5 dpc detected in cells located in the dorsal and ventral neural tube and dorsal root ganglia. Detected during the development of the optic and the auditory systems. At 10.5 dpc, a small ring of ocular staining was observed suggesting expression in the lens pit. At 10.5 dpc expressed in the developing lens epithelium and in the mesenchyme surrounding the retina. However, expression in the lens placode ectoderm was not detected, suggesting that DACH2 is activated after lens vesicle formation. Low levels of expression could also be detected in the peripheral neuroretina at 10.5 and 12.5 dpc. Detected in the otic pit at 9.5 dpc and in the otic endolymphatic duct at 10.5, 11.5 and 12.5 dpc. From 10.5 to 14.5 dpc detected in the developing fore and hind limbs. At 10.5 and 11.5 dpc observed in the anterior and posterior margins and presumptive hand plate of the limb bud. At 9.5 and 10.5 dpc expressed in the limb. At 12.5 dpc is detected in the hand plate with strong expression at the margins of the limb plate. At 14.5 dpc detected in the hand plate and lateral edges of the digits. At 8.5 dpc expression was not detected in the developing somites. In contrast, from 9.5 to 12.5 dpc, expression is detected in a repeated pattern located lateral to the neural tube and in the interlimb bud region suggesting expression in somite derivatives. At 9.5 dpc detected in the forelimb dermamyotome. Also located along the lateral portion of the trunk and within a dorsal domain within the limb bud. At 10.5 dpc expressed in lateral and limb mesoderm. From 9.5 to 10.5 dpc detected in head mesenchyme and the branchial arches. At 9.5 and 10 dpc. expressed in the head mesoderm associated with the developing eye. At 10.5 dpc this pattern appears as a ring of expression surrounding the eye. At 11.5 dpc expression is still detectable in the branchial arches with strong expression at the cranial sinus. At 14.5 dpc mammary gland primordia. Detected in the nasal openings and vibrissae. Ref.1 |
| Domain | The DACHbox-N domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain By similarity. |
| Sequence similarities | Belongs to the DACH/dachshund family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | DNA-binding |
| Molecular function | Developmental protein Repressor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | development of primary female sexual characteristics Inferred from genetic interaction PubMed 18395837. Source: MGI regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q925Q8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q925Q8-2) The sequence of this isoform differs from the canonical sequence as follows: 170-182: Missing. 619-634: GGNYYCLAMAQQLCSA → A | ||||||
| Isoform 3 (identifier: Q925Q8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-174: Missing. 449-449: E → DIQLSQHHLLNTFLHWIELAPLSKKSLHHQK 498-498: Q → QVNNISINKIN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 634 | 634 | Dachshund homolog 2 | PRO_0000095600 | |||||
Regions | |||||||||
| Region | 76 – 162 | 87 | DACHbox-N | ||||||
| Region | 488 – 568 | 81 | DACHbox-C | ||||||
| Coiled coil | 494 – 588 | 95 | Potential | ||||||
| Compositional bias | 357 – 360 | 4 | Poly-Ala | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 174 | 174 | Missing in isoform 3. | VSP_009495 | |||||
| Alternative sequence | 170 – 182 | 13 | Missing in isoform 2. | VSP_009493 | |||||
| Alternative sequence | 449 | 1 | E → DIQLSQHHLLNTFLHWIELA PLSKKSLHHQK in isoform 3. | VSP_009496 | |||||
| Alternative sequence | 498 | 1 | Q → QVNNISINKIN in isoform 3. | VSP_009497 | |||||
| Alternative sequence | 619 – 634 | 16 | GGNYY…QLCSA → A in isoform 2. | VSP_009494 | |||||
Experimental info | |||||||||
| Sequence conflict | 507 | 1 | N → D in BAC28138. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of mouse Dach2, a homologue of Drosophila dachshund." Davis R.J., Shen W., Sandler Y.I., Heanue T.A., Mardon G. Mech. Dev. 102:169-179(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: Swiss Webster / NIH. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. Tissue: Eye. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Brain. |
| [4] | "Tissue-specific regulation of retinal and pituitary precursor cell proliferation." Li X., Perissi V., Liu F., Rose D.W., Rosenfeld M.G. Science 297:1180-1183(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SIX6. |
| [5] | "Pax3 and Dach2 positive regulation in the developing somite." Kardon G., Heanue T.A., Tabin C.J. Dev. Dyn. 224:350-355(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF257217 mRNA. Translation: AAK39983.1. AK033050 mRNA. Translation: BAC28138.1. BC059233 mRNA. Translation: AAH59233.1. |
| IPI | IPI00403444. IPI00403445. IPI00403446. |
| RefSeq | NP_001136042.1. NM_001142570.1. NP_291083.1. NM_033605.2. |
| UniGene | Mm.79760. |
3D structure databases | |
| ProteinModelPortal | Q925Q8. |
| SMR | Q925Q8. Positions 73-169. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q925Q8. 1 interaction. |
| STRING | 10090.ENSMUSP00000064393. |
PTM databases | |
| PhosphoSite | Q925Q8. |
Proteomic databases | |
| PRIDE | Q925Q8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000067219; ENSMUSP00000064393; ENSMUSG00000025592. ENSMUST00000113380; ENSMUSP00000109007; ENSMUSG00000025592. ENSMUST00000113382; ENSMUSP00000109009; ENSMUSG00000025592. |
| GeneID | 93837. |
| KEGG | mmu:93837. |
Organism-specific databases | |
| CTD | 117154. |
| MGI | MGI:1890446. Dach2. |
Phylogenomic databases | |
| eggNOG | NOG279124. |
| GeneTree | ENSGT00390000001134. |
| HOGENOM | HOG000293309. |
| HOVERGEN | HBG065810. |
| InParanoid | Q925Q8. |
| OrthoDB | EOG4NKBVG. |
Gene expression databases | |
| ArrayExpress | Q925Q8. |
| Bgee | Q925Q8. |
| CleanEx | MM_DACH2. |
| Genevestigator | Q925Q8. |
| GermOnline | ENSMUSG00000025592. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.10.260.20. 1 hit. |
| InterPro | IPR009061. DNA-bd_dom_put. IPR003380. Transform_Ski. [Graphical view] |
| Pfam | PF02437. Ski_Sno. 1 hit. [Graphical view] |
| SUPFAM | SSF46955. Putativ_DNA_bind. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DACH2. mouse. |
| NextBio | 351689. |
| SOURCE | Search... |
Entry information
| Entry name | DACH2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q925Q8 Secondary accession number(s): Q8BMA0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
