Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92598

- HS105_HUMAN

UniProt

Q92598 - HS105_HUMAN

Protein

Heat shock protein 105 kDa

Gene

HSPH1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 1 (01 Feb 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities By similarity.By similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein binding Source: IntAct

    GO - Biological processi

    1. chaperone mediated protein folding requiring cofactor Source: Ensembl
    2. positive regulation of MHC class I biosynthetic process Source: BHF-UCL
    3. positive regulation of NK T cell activation Source: BHF-UCL
    4. response to unfolded protein Source: ProtInc

    Keywords - Biological processi

    Stress response

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_163813. Scavenging by Class F Receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heat shock protein 105 kDa
    Alternative name(s):
    Antigen NY-CO-25
    Heat shock 110 kDa protein
    Gene namesi
    Name:HSPH1
    Synonyms:HSP105, HSP110, KIAA0201
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:16969. HSPH1.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: BHF-UCL
    2. cytosol Source: UniProt
    3. endocytic vesicle lumen Source: Reactome
    4. extracellular region Source: BHF-UCL
    5. extracellular vesicular exosome Source: UniProt
    6. microtubule Source: Ensembl
    7. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134869917.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 858857Heat shock protein 105 kDaPRO_0000078284Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserine1 Publication
    Modified residuei471 – 4711N6-acetyllysineBy similarity
    Modified residuei509 – 5091PhosphoserineBy similarity
    Modified residuei557 – 5571Phosphoserine2 Publications
    Modified residuei809 – 8091Phosphoserine4 Publications
    Modified residuei815 – 8151Phosphothreonine1 Publication

    Post-translational modificationi

    Phosphorylation on Ser-509 may be important for regulation of the HSPA8/HSC70 chaperone activity.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ92598.
    PaxDbiQ92598.
    PRIDEiQ92598.

    2D gel databases

    REPRODUCTION-2DPAGEQ92598.

    PTM databases

    PhosphoSiteiQ92598.

    Miscellaneous databases

    PMAP-CutDBQ92598.

    Expressioni

    Tissue specificityi

    Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.2 Publications

    Gene expression databases

    ArrayExpressiQ92598.
    BgeeiQ92598.
    CleanExiHS_HSPH1.
    GenevestigatoriQ92598.

    Organism-specific databases

    HPAiCAB002060.
    HPA028675.
    HPA031569.

    Interactioni

    Subunit structurei

    Interacts with HSPA8/HSC70.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Q96BE03EBI-356829,EBI-9356686
    Phlda1Q623922EBI-356829,EBI-309727From a different organism.

    Protein-protein interaction databases

    BioGridi116022. 56 interactions.
    IntActiQ92598. 25 interactions.
    MINTiMINT-1374987.
    STRINGi9606.ENSP00000318687.

    Structurei

    3D structure databases

    ProteinModelPortaliQ92598.
    SMRiQ92598. Positions 5-714.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the heat shock protein 70 family.Curated

    Phylogenomic databases

    eggNOGiCOG0443.
    HOGENOMiHOG000228138.
    HOVERGENiHBG047955.
    InParanoidiQ92598.
    KOiK09485.
    OrthoDBiEOG77M8N0.
    PhylomeDBiQ92598.
    TreeFamiTF105043.

    Family and domain databases

    Gene3Di1.20.1270.10. 1 hit.
    2.60.34.10. 2 hits.
    InterProiIPR018181. Heat_shock_70_CS.
    IPR029048. HSP70_C.
    IPR029047. HSP70_peptide-bd.
    IPR013126. Hsp_70_fam.
    [Graphical view]
    PfamiPF00012. HSP70. 1 hit.
    [Graphical view]
    PRINTSiPR00301. HEATSHOCK70.
    SUPFAMiSSF100920. SSF100920. 2 hits.
    SSF100934. SSF100934. 2 hits.
    PROSITEiPS01036. HSP70_3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: Q92598-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVVGLDVGS QSCYIAVARA GGIETIANEF SDRCTPSVIS FGSKNRTIGV    50
    AAKNQQITHA NNTVSNFKRF HGRAFNDPFI QKEKENLSYD LVPLKNGGVG 100
    IKVMYMGEEH LFSVEQITAM LLTKLKETAE NSLKKPVTDC VISVPSFFTD 150
    AERRSVLDAA QIVGLNCLRL MNDMTAVALN YGIYKQDLPS LDEKPRIVVF 200
    VDMGHSAFQV SACAFNKGKL KVLGTAFDPF LGGKNFDEKL VEHFCAEFKT 250
    KYKLDAKSKI RALLRLYQEC EKLKKLMSSN STDLPLNIEC FMNDKDVSGK 300
    MNRSQFEELC AELLQKIEVP LYSLLEQTHL KVEDVSAVEI VGGATRIPAV 350
    KERIAKFFGK DISTTLNADE AVARGCALQC AILSPAFKVR EFSVTDAVPF 400
    PISLIWNHDS EDTEGVHEVF SRNHAAPFSK VLTFLRRGPF ELEAFYSDPQ 450
    GVPYPEAKIG RFVVQNVSAQ KDGEKSRVKV KVRVNTHGIF TISTASMVEK 500
    VPTEENEMSS EADMECLNQR PPENPDTDKN VQQDNSEAGT QPQVQTDAQQ 550
    TSQSPPSPEL TSEENKIPDA DKANEKKVDQ PPEAKKPKIK VVNVELPIEA 600
    NLVWQLGKDL LNMYIETEGK MIMQDKLEKE RNDAKNAVEE YVYEFRDKLC 650
    GPYEKFICEQ DHQNFLRLLT ETEDWLYEEG EDQAKQAYVD KLEELMKIGT 700
    PVKVRFQEAE ERPKMFEELG QRLQHYAKIA ADFRNKDEKY NHIDESEMKK 750
    VEKSVNEVME WMNNVMNAQA KKSLDQDPVV RAQEIKTKIK ELNNTCEPVV 800
    TQPKPKIESP KLERTPNGPN IDKKEEDLED KNNFGAEPPH QNGECYPNEK 850
    NSVNMDLD 858
    Length:858
    Mass (Da):96,865
    Last modified:February 1, 1997 - v1
    Checksum:iD0E757970E340B56
    GO
    Isoform Beta (identifier: Q92598-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         529-572: Missing.

    Show »
    Length:814
    Mass (Da):92,116
    Checksum:i10272B4D373289E8
    GO
    Isoform 3 (identifier: Q92598-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         104-144: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:817
    Mass (Da):92,255
    Checksum:i19C55A76242953F2
    GO
    Isoform 4 (identifier: Q92598-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP → MATAAVLRGPAAHWVESFQKAREEGSGSGTWRGRWRRR

    Note: No experimental confirmation available.

    Show »
    Length:860
    Mass (Da):97,460
    Checksum:i39535248100C9B9C
    GO

    Sequence cautioni

    The sequence AAC18044.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA13192.2 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636MSVVG…DRCTP → MATAAVLRGPAAHWVESFQK AREEGSGSGTWRGRWRRR in isoform 4. 1 PublicationVSP_054883Add
    BLAST
    Alternative sequencei104 – 14441Missing in isoform 3. CuratedVSP_035428Add
    BLAST
    Alternative sequencei529 – 57244Missing in isoform Beta. 1 PublicationVSP_002428Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB003333 mRNA. Translation: BAA34779.1.
    AB003334 mRNA. Translation: BAA34780.1.
    AF039695 mRNA. Translation: AAC18044.1. Different initiation.
    D86956 mRNA. Translation: BAA13192.2. Different initiation.
    AK302430 mRNA. Translation: BAG63733.1.
    AL137142 Genomic DNA. Translation: CAI12428.1.
    AL137142 Genomic DNA. Translation: CAI12429.1.
    AL137142 Genomic DNA. Translation: CAI12430.1.
    CH471075 Genomic DNA. Translation: EAX08479.1.
    CH471075 Genomic DNA. Translation: EAX08482.1.
    BC037553 mRNA. Translation: AAH37553.1.
    CCDSiCCDS66525.1. [Q92598-2]
    CCDS66526.1. [Q92598-4]
    CCDS9340.1. [Q92598-1]
    RefSeqiNP_001273432.1. NM_001286503.1. [Q92598-2]
    NP_001273433.1. NM_001286504.1. [Q92598-4]
    NP_001273434.1. NM_001286505.1.
    NP_006635.2. NM_006644.3. [Q92598-1]
    UniGeneiHs.743267.

    Genome annotation databases

    EnsembliENST00000320027; ENSP00000318687; ENSG00000120694. [Q92598-1]
    ENST00000380405; ENSP00000369768; ENSG00000120694. [Q92598-2]
    ENST00000445273; ENSP00000396090; ENSG00000120694. [Q92598-4]
    GeneIDi10808.
    KEGGihsa:10808.
    UCSCiuc001utj.3. human. [Q92598-1]
    uc001utk.3. human. [Q92598-2]
    uc001utl.3. human.
    uc010aaw.3. human. [Q92598-3]

    Polymorphism databases

    DMDMi2495344.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB003333 mRNA. Translation: BAA34779.1 .
    AB003334 mRNA. Translation: BAA34780.1 .
    AF039695 mRNA. Translation: AAC18044.1 . Different initiation.
    D86956 mRNA. Translation: BAA13192.2 . Different initiation.
    AK302430 mRNA. Translation: BAG63733.1 .
    AL137142 Genomic DNA. Translation: CAI12428.1 .
    AL137142 Genomic DNA. Translation: CAI12429.1 .
    AL137142 Genomic DNA. Translation: CAI12430.1 .
    CH471075 Genomic DNA. Translation: EAX08479.1 .
    CH471075 Genomic DNA. Translation: EAX08482.1 .
    BC037553 mRNA. Translation: AAH37553.1 .
    CCDSi CCDS66525.1. [Q92598-2 ]
    CCDS66526.1. [Q92598-4 ]
    CCDS9340.1. [Q92598-1 ]
    RefSeqi NP_001273432.1. NM_001286503.1. [Q92598-2 ]
    NP_001273433.1. NM_001286504.1. [Q92598-4 ]
    NP_001273434.1. NM_001286505.1.
    NP_006635.2. NM_006644.3. [Q92598-1 ]
    UniGenei Hs.743267.

    3D structure databases

    ProteinModelPortali Q92598.
    SMRi Q92598. Positions 5-714.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116022. 56 interactions.
    IntActi Q92598. 25 interactions.
    MINTi MINT-1374987.
    STRINGi 9606.ENSP00000318687.

    PTM databases

    PhosphoSitei Q92598.

    Polymorphism databases

    DMDMi 2495344.

    2D gel databases

    REPRODUCTION-2DPAGE Q92598.

    Proteomic databases

    MaxQBi Q92598.
    PaxDbi Q92598.
    PRIDEi Q92598.

    Protocols and materials databases

    DNASUi 10808.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000320027 ; ENSP00000318687 ; ENSG00000120694 . [Q92598-1 ]
    ENST00000380405 ; ENSP00000369768 ; ENSG00000120694 . [Q92598-2 ]
    ENST00000445273 ; ENSP00000396090 ; ENSG00000120694 . [Q92598-4 ]
    GeneIDi 10808.
    KEGGi hsa:10808.
    UCSCi uc001utj.3. human. [Q92598-1 ]
    uc001utk.3. human. [Q92598-2 ]
    uc001utl.3. human.
    uc010aaw.3. human. [Q92598-3 ]

    Organism-specific databases

    CTDi 10808.
    GeneCardsi GC13M031710.
    HGNCi HGNC:16969. HSPH1.
    HPAi CAB002060.
    HPA028675.
    HPA031569.
    MIMi 610703. gene.
    neXtProti NX_Q92598.
    PharmGKBi PA134869917.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0443.
    HOGENOMi HOG000228138.
    HOVERGENi HBG047955.
    InParanoidi Q92598.
    KOi K09485.
    OrthoDBi EOG77M8N0.
    PhylomeDBi Q92598.
    TreeFami TF105043.

    Enzyme and pathway databases

    Reactomei REACT_163813. Scavenging by Class F Receptors.

    Miscellaneous databases

    ChiTaRSi HSPH1. human.
    GeneWikii HSPH1.
    GenomeRNAii 10808.
    NextBioi 35476214.
    PMAP-CutDB Q92598.
    PROi Q92598.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q92598.
    Bgeei Q92598.
    CleanExi HS_HSPH1.
    Genevestigatori Q92598.

    Family and domain databases

    Gene3Di 1.20.1270.10. 1 hit.
    2.60.34.10. 2 hits.
    InterProi IPR018181. Heat_shock_70_CS.
    IPR029048. HSP70_C.
    IPR029047. HSP70_peptide-bd.
    IPR013126. Hsp_70_fam.
    [Graphical view ]
    Pfami PF00012. HSP70. 1 hit.
    [Graphical view ]
    PRINTSi PR00301. HEATSHOCK70.
    SUPFAMi SSF100920. SSF100920. 2 hits.
    SSF100934. SSF100934. 2 hits.
    PROSITEi PS01036. HSP70_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning, expression and localization of human 105 kDa heat shock protein, hsp105."
      Ishihara K., Yasuda K., Hatayama T.
      Biochim. Biophys. Acta 1444:138-142(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA), SUBCELLULAR LOCATION.
    2. "Characterization of human colon cancer antigens recognized by autologous antibodies."
      Scanlan M.J., Chen Y.-T., Williamson B., Gure A.O., Stockert E., Gordan J.D., Tuereci O., Sahin U., Pfreundschuh M., Old L.J.
      Int. J. Cancer 76:652-658(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
      Tissue: Colon carcinoma.
    3. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
      Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
      DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Tissue: Bone marrow.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Testis.
    5. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Tissue: Testis.
    8. Lubec G., Chen W.-Q., Sun Y.
      Submitted (DEC-2008) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 332-346 AND 375-388, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Fetal brain cortex.
    9. "The distribution and localization of hsp110 in brain."
      Hylander B.L., Chen X., Graf P.C.F., Subjeck J.R.
      Brain Res. 869:49-55(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    10. "DNA vaccination of HSP105 leads to tumor rejection of colorectal cancer and melanoma in mice through activation of both CD4 T cells and CD8 T cells."
      Miyazaki M., Nakatsura T., Yokomine K., Senju S., Monji M., Hosaka S., Komori H., Yoshitake Y., Motomura Y., Minohara M., Kubo T., Ishihara K., Hatayama T., Ogawa M., Nishimura Y.
      Cancer Sci. 96:695-705(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-557; SER-809 AND THR-815, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-557 AND SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    18. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiHS105_HUMAN
    AccessioniPrimary (citable) accession number: Q92598
    Secondary accession number(s): B4DYH1
    , O95739, Q5TBM6, Q5TBM7, Q5TBM8, Q9UPC4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: February 1, 1997
    Last modified: October 1, 2014
    This is version 154 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3