SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92598

- HS105_HUMAN

UniProt

Q92598 - HS105_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Heat shock protein 105 kDa
Gene
HSPH1, HSP105, HSP110, KIAA0201
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities By similarity.

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. protein binding Source: IntAct

GO - Biological processi

  1. chaperone mediated protein folding requiring cofactor Source: Ensembl
  2. positive regulation of MHC class I biosynthetic process Source: BHF-UCL
  3. positive regulation of NK T cell activation Source: BHF-UCL
  4. response to unfolded protein Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Stress response

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_163813. Scavenging by Class F Receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock protein 105 kDa
Alternative name(s):
Antigen NY-CO-25
Heat shock 110 kDa protein
Gene namesi
Name:HSPH1
Synonyms:HSP105, HSP110, KIAA0201
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:16969. HSPH1.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. cytosol Source: UniProt
  3. endocytic vesicle lumen Source: Reactome
  4. extracellular region Source: BHF-UCL
  5. extracellular vesicular exosome Source: UniProt
  6. microtubule Source: Ensembl
  7. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134869917.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 858857Heat shock protein 105 kDa
PRO_0000078284Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine1 Publication
Modified residuei471 – 4711N6-acetyllysine By similarity
Modified residuei509 – 5091Phosphoserine By similarity
Modified residuei557 – 5571Phosphoserine2 Publications
Modified residuei809 – 8091Phosphoserine4 Publications
Modified residuei815 – 8151Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylation on Ser-509 may be important for regulation of the HSPA8/HSC70 chaperone activity By similarity.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ92598.
PaxDbiQ92598.
PRIDEiQ92598.

2D gel databases

REPRODUCTION-2DPAGEQ92598.

PTM databases

PhosphoSiteiQ92598.

Miscellaneous databases

PMAP-CutDBQ92598.

Expressioni

Tissue specificityi

Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.2 Publications

Gene expression databases

ArrayExpressiQ92598.
BgeeiQ92598.
CleanExiHS_HSPH1.
GenevestigatoriQ92598.

Organism-specific databases

HPAiCAB002060.
HPA028675.
HPA031569.

Interactioni

Subunit structurei

Interacts with HSPA8/HSC70 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
Phlda1Q623922EBI-356829,EBI-309727From a different organism.

Protein-protein interaction databases

BioGridi116022. 56 interactions.
IntActiQ92598. 22 interactions.
MINTiMINT-1374987.
STRINGi9606.ENSP00000318687.

Structurei

3D structure databases

ProteinModelPortaliQ92598.
SMRiQ92598. Positions 5-714.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0443.
HOGENOMiHOG000228138.
HOVERGENiHBG047955.
InParanoidiQ92598.
KOiK09485.
OrthoDBiEOG77M8N0.
PhylomeDBiQ92598.
TreeFamiTF105043.

Family and domain databases

Gene3Di1.20.1270.10. 1 hit.
2.60.34.10. 2 hits.
InterProiIPR018181. Heat_shock_70_CS.
IPR029048. HSP70_C.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
[Graphical view]
PfamiPF00012. HSP70. 1 hit.
[Graphical view]
PRINTSiPR00301. HEATSHOCK70.
SUPFAMiSSF100920. SSF100920. 2 hits.
SSF100934. SSF100934. 2 hits.
PROSITEiPS01036. HSP70_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: Q92598-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSVVGLDVGS QSCYIAVARA GGIETIANEF SDRCTPSVIS FGSKNRTIGV    50
AAKNQQITHA NNTVSNFKRF HGRAFNDPFI QKEKENLSYD LVPLKNGGVG 100
IKVMYMGEEH LFSVEQITAM LLTKLKETAE NSLKKPVTDC VISVPSFFTD 150
AERRSVLDAA QIVGLNCLRL MNDMTAVALN YGIYKQDLPS LDEKPRIVVF 200
VDMGHSAFQV SACAFNKGKL KVLGTAFDPF LGGKNFDEKL VEHFCAEFKT 250
KYKLDAKSKI RALLRLYQEC EKLKKLMSSN STDLPLNIEC FMNDKDVSGK 300
MNRSQFEELC AELLQKIEVP LYSLLEQTHL KVEDVSAVEI VGGATRIPAV 350
KERIAKFFGK DISTTLNADE AVARGCALQC AILSPAFKVR EFSVTDAVPF 400
PISLIWNHDS EDTEGVHEVF SRNHAAPFSK VLTFLRRGPF ELEAFYSDPQ 450
GVPYPEAKIG RFVVQNVSAQ KDGEKSRVKV KVRVNTHGIF TISTASMVEK 500
VPTEENEMSS EADMECLNQR PPENPDTDKN VQQDNSEAGT QPQVQTDAQQ 550
TSQSPPSPEL TSEENKIPDA DKANEKKVDQ PPEAKKPKIK VVNVELPIEA 600
NLVWQLGKDL LNMYIETEGK MIMQDKLEKE RNDAKNAVEE YVYEFRDKLC 650
GPYEKFICEQ DHQNFLRLLT ETEDWLYEEG EDQAKQAYVD KLEELMKIGT 700
PVKVRFQEAE ERPKMFEELG QRLQHYAKIA ADFRNKDEKY NHIDESEMKK 750
VEKSVNEVME WMNNVMNAQA KKSLDQDPVV RAQEIKTKIK ELNNTCEPVV 800
TQPKPKIESP KLERTPNGPN IDKKEEDLED KNNFGAEPPH QNGECYPNEK 850
NSVNMDLD 858
Length:858
Mass (Da):96,865
Last modified:February 1, 1997 - v1
Checksum:iD0E757970E340B56
GO
Isoform Beta (identifier: Q92598-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-572: Missing.

Show »
Length:814
Mass (Da):92,116
Checksum:i10272B4D373289E8
GO
Isoform 3 (identifier: Q92598-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-144: Missing.

Note: No experimental confirmation available.

Show »
Length:817
Mass (Da):92,255
Checksum:i19C55A76242953F2
GO
Isoform 4 (identifier: Q92598-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP → MATAAVLRGPAAHWVESFQKAREEGSGSGTWRGRWRRR

Note: No experimental confirmation available.

Show »
Length:860
Mass (Da):97,460
Checksum:i39535248100C9B9C
GO

Sequence cautioni

The sequence AAC18044.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA13192.2 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MSVVG…DRCTP → MATAAVLRGPAAHWVESFQK AREEGSGSGTWRGRWRRR in isoform 4.
VSP_054883Add
BLAST
Alternative sequencei104 – 14441Missing in isoform 3.
VSP_035428Add
BLAST
Alternative sequencei529 – 57244Missing in isoform Beta.
VSP_002428Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB003333 mRNA. Translation: BAA34779.1.
AB003334 mRNA. Translation: BAA34780.1.
AF039695 mRNA. Translation: AAC18044.1. Different initiation.
D86956 mRNA. Translation: BAA13192.2. Different initiation.
AK302430 mRNA. Translation: BAG63733.1.
AL137142 Genomic DNA. Translation: CAI12428.1.
AL137142 Genomic DNA. Translation: CAI12429.1.
AL137142 Genomic DNA. Translation: CAI12430.1.
CH471075 Genomic DNA. Translation: EAX08479.1.
CH471075 Genomic DNA. Translation: EAX08482.1.
BC037553 mRNA. Translation: AAH37553.1.
CCDSiCCDS66525.1. [Q92598-2]
CCDS66526.1. [Q92598-4]
CCDS9340.1. [Q92598-1]
RefSeqiNP_001273432.1. NM_001286503.1. [Q92598-2]
NP_001273433.1. NM_001286504.1. [Q92598-4]
NP_001273434.1. NM_001286505.1.
NP_006635.2. NM_006644.3. [Q92598-1]
UniGeneiHs.743267.

Genome annotation databases

EnsembliENST00000320027; ENSP00000318687; ENSG00000120694. [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694. [Q92598-2]
ENST00000380406; ENSP00000369769; ENSG00000120694. [Q92598-3]
ENST00000445273; ENSP00000396090; ENSG00000120694.
GeneIDi10808.
KEGGihsa:10808.
UCSCiuc001utj.3. human. [Q92598-1]
uc001utk.3. human. [Q92598-2]
uc001utl.3. human.
uc010aaw.3. human. [Q92598-3]

Polymorphism databases

DMDMi2495344.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB003333 mRNA. Translation: BAA34779.1 .
AB003334 mRNA. Translation: BAA34780.1 .
AF039695 mRNA. Translation: AAC18044.1 . Different initiation.
D86956 mRNA. Translation: BAA13192.2 . Different initiation.
AK302430 mRNA. Translation: BAG63733.1 .
AL137142 Genomic DNA. Translation: CAI12428.1 .
AL137142 Genomic DNA. Translation: CAI12429.1 .
AL137142 Genomic DNA. Translation: CAI12430.1 .
CH471075 Genomic DNA. Translation: EAX08479.1 .
CH471075 Genomic DNA. Translation: EAX08482.1 .
BC037553 mRNA. Translation: AAH37553.1 .
CCDSi CCDS66525.1. [Q92598-2 ]
CCDS66526.1. [Q92598-4 ]
CCDS9340.1. [Q92598-1 ]
RefSeqi NP_001273432.1. NM_001286503.1. [Q92598-2 ]
NP_001273433.1. NM_001286504.1. [Q92598-4 ]
NP_001273434.1. NM_001286505.1.
NP_006635.2. NM_006644.3. [Q92598-1 ]
UniGenei Hs.743267.

3D structure databases

ProteinModelPortali Q92598.
SMRi Q92598. Positions 5-714.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116022. 56 interactions.
IntActi Q92598. 22 interactions.
MINTi MINT-1374987.
STRINGi 9606.ENSP00000318687.

PTM databases

PhosphoSitei Q92598.

Polymorphism databases

DMDMi 2495344.

2D gel databases

REPRODUCTION-2DPAGE Q92598.

Proteomic databases

MaxQBi Q92598.
PaxDbi Q92598.
PRIDEi Q92598.

Protocols and materials databases

DNASUi 10808.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000320027 ; ENSP00000318687 ; ENSG00000120694 . [Q92598-1 ]
ENST00000380405 ; ENSP00000369768 ; ENSG00000120694 . [Q92598-2 ]
ENST00000380406 ; ENSP00000369769 ; ENSG00000120694 . [Q92598-3 ]
ENST00000445273 ; ENSP00000396090 ; ENSG00000120694 .
GeneIDi 10808.
KEGGi hsa:10808.
UCSCi uc001utj.3. human. [Q92598-1 ]
uc001utk.3. human. [Q92598-2 ]
uc001utl.3. human.
uc010aaw.3. human. [Q92598-3 ]

Organism-specific databases

CTDi 10808.
GeneCardsi GC13M031710.
HGNCi HGNC:16969. HSPH1.
HPAi CAB002060.
HPA028675.
HPA031569.
MIMi 610703. gene.
neXtProti NX_Q92598.
PharmGKBi PA134869917.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0443.
HOGENOMi HOG000228138.
HOVERGENi HBG047955.
InParanoidi Q92598.
KOi K09485.
OrthoDBi EOG77M8N0.
PhylomeDBi Q92598.
TreeFami TF105043.

Enzyme and pathway databases

Reactomei REACT_163813. Scavenging by Class F Receptors.

Miscellaneous databases

ChiTaRSi HSPH1. human.
GeneWikii HSPH1.
GenomeRNAii 10808.
NextBioi 35476214.
PMAP-CutDB Q92598.
PROi Q92598.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q92598.
Bgeei Q92598.
CleanExi HS_HSPH1.
Genevestigatori Q92598.

Family and domain databases

Gene3Di 1.20.1270.10. 1 hit.
2.60.34.10. 2 hits.
InterProi IPR018181. Heat_shock_70_CS.
IPR029048. HSP70_C.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
[Graphical view ]
Pfami PF00012. HSP70. 1 hit.
[Graphical view ]
PRINTSi PR00301. HEATSHOCK70.
SUPFAMi SSF100920. SSF100920. 2 hits.
SSF100934. SSF100934. 2 hits.
PROSITEi PS01036. HSP70_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, expression and localization of human 105 kDa heat shock protein, hsp105."
    Ishihara K., Yasuda K., Hatayama T.
    Biochim. Biophys. Acta 1444:138-142(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA), SUBCELLULAR LOCATION.
  2. "Characterization of human colon cancer antigens recognized by autologous antibodies."
    Scanlan M.J., Chen Y.-T., Williamson B., Gure A.O., Stockert E., Gordan J.D., Tuereci O., Sahin U., Pfreundschuh M., Old L.J.
    Int. J. Cancer 76:652-658(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Tissue: Colon carcinoma.
  3. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Bone marrow.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Testis.
  5. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Testis.
  8. Lubec G., Chen W.-Q., Sun Y.
    Submitted (DEC-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 332-346 AND 375-388, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Fetal brain cortex.
  9. "The distribution and localization of hsp110 in brain."
    Hylander B.L., Chen X., Graf P.C.F., Subjeck J.R.
    Brain Res. 869:49-55(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  10. "DNA vaccination of HSP105 leads to tumor rejection of colorectal cancer and melanoma in mice through activation of both CD4 T cells and CD8 T cells."
    Miyazaki M., Nakatsura T., Yokomine K., Senju S., Monji M., Hosaka S., Komori H., Yoshitake Y., Motomura Y., Minohara M., Kubo T., Ishihara K., Hatayama T., Ogawa M., Nishimura Y.
    Cancer Sci. 96:695-705(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-557; SER-809 AND THR-815, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-557 AND SER-809, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiHS105_HUMAN
AccessioniPrimary (citable) accession number: Q92598
Secondary accession number(s): B4DYH1
, O95739, Q5TBM6, Q5TBM7, Q5TBM8, Q9UPC4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: September 3, 2014
This is version 153 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi