Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock protein 105 kDa

Gene

HSPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering client/substrate protein release (PubMed:24318877). Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities (By similarity).By similarity1 Publication

GO - Molecular functioni

  • adenyl-nucleotide exchange factor activity Source: UniProtKB
  • alpha-tubulin binding Source: Ensembl
  • ATP binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processStress response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-3000484. Scavenging by Class F Receptors.
R-HSA-3371453. Regulation of HSF1-mediated heat shock response.
SIGNORiQ92598.

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock protein 105 kDa
Alternative name(s):
Antigen NY-CO-25
Heat shock 110 kDa protein
Gene namesi
Name:HSPH1
Synonyms:HSP105, HSP110, KIAA0201
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:16969. HSPH1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • cytosol Source: UniProtKB
  • endocytic vesicle lumen Source: Reactome
  • extracellular exosome Source: UniProtKB
  • extracellular region Source: BHF-UCL
  • microtubule Source: Ensembl
  • nucleoplasm Source: HPA
  • protein complex Source: UniProtKB

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi10808.
OpenTargetsiENSG00000120694.
PharmGKBiPA134869917.

Chemistry databases

ChEMBLiCHEMBL3706560.

Polymorphism and mutation databases

DMDMi2495344.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000782842 – 858Heat shock protein 105 kDaAdd BLAST857

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei471N6-acetyllysineBy similarity1
Modified residuei509PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei561PhosphothreonineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Modified residuei815PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylation on Ser-509 may be important for regulation of the HSPA8/HSC70 chaperone activity.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ92598.
MaxQBiQ92598.
PaxDbiQ92598.
PeptideAtlasiQ92598.
PRIDEiQ92598.

2D gel databases

REPRODUCTION-2DPAGEiQ92598.

PTM databases

iPTMnetiQ92598.
PhosphoSitePlusiQ92598.
SwissPalmiQ92598.

Miscellaneous databases

PMAP-CutDBiQ92598.

Expressioni

Tissue specificityi

Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.2 Publications

Gene expression databases

BgeeiENSG00000120694.
CleanExiHS_HSPH1.
ExpressionAtlasiQ92598. baseline and differential.
GenevisibleiQ92598. HS.

Organism-specific databases

HPAiCAB002060.
HPA028675.
HPA031569.

Interactioni

Subunit structurei

Interacts with HSPA8/HSC70 (By similarity). Interacts with HSPA1A (via NBD) and HSPA1B (via NBD) (PubMed:24318877).By similarity1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116022. 94 interactors.
IntActiQ92598. 39 interactors.
MINTiMINT-1374987.
STRINGi9606.ENSP00000318687.

Structurei

3D structure databases

ProteinModelPortaliQ92598.
SMRiQ92598.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

eggNOGiKOG0103. Eukaryota.
COG0443. LUCA.
GeneTreeiENSGT00390000016919.
HOGENOMiHOG000228138.
HOVERGENiHBG047955.
InParanoidiQ92598.
KOiK09485.
OMAiMNDMTAV.
OrthoDBiEOG091G04Y6.
PhylomeDBiQ92598.
TreeFamiTF105043.

Family and domain databases

Gene3Di1.20.1270.10. 2 hits.
2.60.34.10. 1 hit.
InterProiView protein in InterPro
IPR018181. Heat_shock_70_CS.
IPR029048. HSP70_C.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
PfamiView protein in Pfam
PF00012. HSP70. 1 hit.
PRINTSiPR00301. HEATSHOCK70.
SUPFAMiSSF100920. SSF100920. 2 hits.
SSF100934. SSF100934. 2 hits.
PROSITEiView protein in PROSITE
PS01036. HSP70_3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Alpha (identifier: Q92598-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVVGLDVGS QSCYIAVARA GGIETIANEF SDRCTPSVIS FGSKNRTIGV
60 70 80 90 100
AAKNQQITHA NNTVSNFKRF HGRAFNDPFI QKEKENLSYD LVPLKNGGVG
110 120 130 140 150
IKVMYMGEEH LFSVEQITAM LLTKLKETAE NSLKKPVTDC VISVPSFFTD
160 170 180 190 200
AERRSVLDAA QIVGLNCLRL MNDMTAVALN YGIYKQDLPS LDEKPRIVVF
210 220 230 240 250
VDMGHSAFQV SACAFNKGKL KVLGTAFDPF LGGKNFDEKL VEHFCAEFKT
260 270 280 290 300
KYKLDAKSKI RALLRLYQEC EKLKKLMSSN STDLPLNIEC FMNDKDVSGK
310 320 330 340 350
MNRSQFEELC AELLQKIEVP LYSLLEQTHL KVEDVSAVEI VGGATRIPAV
360 370 380 390 400
KERIAKFFGK DISTTLNADE AVARGCALQC AILSPAFKVR EFSVTDAVPF
410 420 430 440 450
PISLIWNHDS EDTEGVHEVF SRNHAAPFSK VLTFLRRGPF ELEAFYSDPQ
460 470 480 490 500
GVPYPEAKIG RFVVQNVSAQ KDGEKSRVKV KVRVNTHGIF TISTASMVEK
510 520 530 540 550
VPTEENEMSS EADMECLNQR PPENPDTDKN VQQDNSEAGT QPQVQTDAQQ
560 570 580 590 600
TSQSPPSPEL TSEENKIPDA DKANEKKVDQ PPEAKKPKIK VVNVELPIEA
610 620 630 640 650
NLVWQLGKDL LNMYIETEGK MIMQDKLEKE RNDAKNAVEE YVYEFRDKLC
660 670 680 690 700
GPYEKFICEQ DHQNFLRLLT ETEDWLYEEG EDQAKQAYVD KLEELMKIGT
710 720 730 740 750
PVKVRFQEAE ERPKMFEELG QRLQHYAKIA ADFRNKDEKY NHIDESEMKK
760 770 780 790 800
VEKSVNEVME WMNNVMNAQA KKSLDQDPVV RAQEIKTKIK ELNNTCEPVV
810 820 830 840 850
TQPKPKIESP KLERTPNGPN IDKKEEDLED KNNFGAEPPH QNGECYPNEK

NSVNMDLD
Length:858
Mass (Da):96,865
Last modified:February 1, 1997 - v1
Checksum:iD0E757970E340B56
GO
Isoform Beta (identifier: Q92598-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-572: Missing.

Show »
Length:814
Mass (Da):92,116
Checksum:i10272B4D373289E8
GO
Isoform 3 (identifier: Q92598-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-144: Missing.

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):92,255
Checksum:i19C55A76242953F2
GO
Isoform 4 (identifier: Q92598-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP → MATAAVLRGPAAHWVESFQKAREEGSGSGTWRGRWRRR

Note: No experimental confirmation available.
Show »
Length:860
Mass (Da):97,460
Checksum:i39535248100C9B9C
GO

Sequence cautioni

The sequence AAC18044 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA13192 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548831 – 36MSVVG…DRCTP → MATAAVLRGPAAHWVESFQK AREEGSGSGTWRGRWRRR in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035428104 – 144Missing in isoform 3. CuratedAdd BLAST41
Alternative sequenceiVSP_002428529 – 572Missing in isoform Beta. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003333 mRNA. Translation: BAA34779.1.
AB003334 mRNA. Translation: BAA34780.1.
AF039695 mRNA. Translation: AAC18044.1. Different initiation.
D86956 mRNA. Translation: BAA13192.2. Different initiation.
AK302430 mRNA. Translation: BAG63733.1.
AL137142 Genomic DNA. Translation: CAI12428.1.
AL137142 Genomic DNA. Translation: CAI12429.1.
AL137142 Genomic DNA. Translation: CAI12430.1.
CH471075 Genomic DNA. Translation: EAX08479.1.
CH471075 Genomic DNA. Translation: EAX08482.1.
BC037553 mRNA. Translation: AAH37553.1.
CCDSiCCDS66525.1. [Q92598-2]
CCDS66526.1. [Q92598-4]
CCDS9340.1. [Q92598-1]
RefSeqiNP_001273432.1. NM_001286503.1. [Q92598-2]
NP_001273433.1. NM_001286504.1. [Q92598-4]
NP_001273434.1. NM_001286505.1.
NP_006635.2. NM_006644.3. [Q92598-1]
UniGeneiHs.743267.

Genome annotation databases

EnsembliENST00000320027; ENSP00000318687; ENSG00000120694. [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694. [Q92598-2]
ENST00000630972; ENSP00000487365; ENSG00000120694. [Q92598-4]
GeneIDi10808.
KEGGihsa:10808.
UCSCiuc001utj.5. human. [Q92598-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHS105_HUMAN
AccessioniPrimary (citable) accession number: Q92598
Secondary accession number(s): B4DYH1
, O95739, Q5TBM6, Q5TBM7, Q5TBM8, Q9UPC4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: August 30, 2017
This is version 184 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families