Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92581

- SL9A6_HUMAN

UniProt

Q92581 - SL9A6_HUMAN

Protein

Sodium/hydrogen exchanger 6

Gene

SLC9A6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 2 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Electroneutral exchange of protons for Na+ and K+ across the early and recycling endosome membranes. Contributes to calcium homeostasis.

    GO - Molecular functioni

    1. sodium:proton antiporter activity Source: ProtInc

    GO - Biological processi

    1. axon extension Source: MGI
    2. dendrite extension Source: MGI
    3. ion transport Source: Reactome
    4. neuron projection morphogenesis Source: MGI
    5. regulation of pH Source: InterPro
    6. sodium ion transmembrane transport Source: GOC
    7. transmembrane transport Source: Reactome
    8. transport Source: ProtInc

    Keywords - Biological processi

    Antiport, Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_19314. Sodium/Proton exchangers.

    Protein family/group databases

    TCDBi2.A.36.1.14. the monovalent cation:proton antiporter-1 (cpa1) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium/hydrogen exchanger 6
    Alternative name(s):
    Na(+)/H(+) exchanger 6
    Short name:
    NHE-6
    Solute carrier family 9 member 6
    Gene namesi
    Name:SLC9A6
    Synonyms:KIAA0267, NHE6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:11079. SLC9A6.

    Subcellular locationi

    Endosome membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane.

    GO - Cellular componenti

    1. early endosome membrane Source: UniProtKB
    2. endoplasmic reticulum membrane Source: UniProtKB
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB
    5. recycling endosome membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endosome, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Mental retardation, X-linked, syndromic, Christianson type (MRXSCH) [MIM:300243]: A syndrome characterized by profound mental retardation, epilepsy, ataxia, and microcephaly. It shows phenotypic overlap with Angelman syndrome.2 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Keywords - Diseasei

    Epilepsy, Mental retardation

    Organism-specific databases

    MIMi300243. phenotype.
    Orphaneti85278. Christianson syndrome.
    PharmGKBiPA35935.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 669669Sodium/hydrogen exchanger 6PRO_0000052362Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi128 – 1281N-linked (GlcNAc...)1 Publication
    Cross-linki443 – 443Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

    Keywords - PTMi

    Glycoprotein, Isopeptide bond, Ubl conjugation

    Proteomic databases

    MaxQBiQ92581.
    PaxDbiQ92581.
    PRIDEiQ92581.

    PTM databases

    PhosphoSiteiQ92581.

    Expressioni

    Tissue specificityi

    Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.

    Gene expression databases

    ArrayExpressiQ92581.
    BgeeiQ92581.
    CleanExiHS_SLC9A6.
    GenevestigatoriQ92581.

    Organism-specific databases

    HPAiHPA059445.

    Interactioni

    Protein-protein interaction databases

    BioGridi115742. 2 interactions.
    STRINGi9606.ENSP00000359729.

    Structurei

    3D structure databases

    ProteinModelPortaliQ92581.
    SMRiQ92581. Positions 218-246, 337-364.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei28 – 4821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei71 – 9121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei103 – 12321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei142 – 16221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei179 – 19921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei220 – 24021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei246 – 26621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei292 – 31221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei340 – 36021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei382 – 40221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei404 – 42421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei447 – 46721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei483 – 50321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0025.
    HOGENOMiHOG000172307.
    HOVERGENiHBG055575.
    KOiK12041.
    OMAiDQEHLGV.
    OrthoDBiEOG7NW69D.
    PhylomeDBiQ92581.
    TreeFamiTF318755.

    Family and domain databases

    InterProiIPR006153. Cation/H_exchanger.
    IPR018422. Cation/H_exchanger_CPA1.
    IPR002090. Na/H_exchanger_6.
    IPR004709. NaH_exchanger.
    [Graphical view]
    PANTHERiPTHR10110. PTHR10110. 1 hit.
    PfamiPF00999. Na_H_Exchanger. 1 hit.
    [Graphical view]
    PRINTSiPR01084. NAHEXCHNGR.
    PR01088. NAHEXCHNGR6.
    TIGRFAMsiTIGR00840. b_cpa1. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q92581-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARRGWRRAP LRRGVGSSPR ARRLMRPLWL LLAVGVFDWA GASDGGGGEA    50
    RAMDEEIVSE KQAEESHRQD SANLLIFILL LTLTILTIWL FKHRRARFLH 100
    ETGLAMIYGL LVGLVLRYGI HVPSDVNNVT LSCEVQSSPT TLLVTFDPEV 150
    FFNILLPPII FYAGYSLKRR HFFRNLGSIL AYAFLGTAIS CFVIGSIMYG 200
    CVTLMKVTGQ LAGDFYFTDC LLFGAIVSAT DPVTVLAIFH ELQVDVELYA 250
    LLFGESVLND AVAIVLSSSI VAYQPAGDNS HTFDVTAMFK SIGIFLGIFS 300
    GSFAMGAATG VVTALVTKFT KLREFQLLET GLFFLMSWST FLLAEAWGFT 350
    GVVAVLFCGI TQAHYTYNNL STESQHRTKQ LFELLNFLAE NFIFSYMGLT 400
    LFTFQNHVFN PTFVVGAFVA IFLGRAANIY PLSLLLNLGR RSKIGSNFQH 450
    MMMFAGLRGA MAFALAIRDT ATYARQMMFS TTLLIVFFTV WVFGGGTTAM 500
    LSCLHIRVGV DSDQEHLGVP ENERRTTKAE SAWLFRMWYN FDHNYLKPLL 550
    THSGPPLTTT LPACCGPIAR CLTSPQAYEN QEQLKDDDSD LILNDGDISL 600
    TYGDSTVNTE PATSSAPRRF MGNSSEDALD RELAFGDHEL VIRGTRLVLP 650
    MDDSEPPLNL LDNTRHGPA 669
    Length:669
    Mass (Da):74,162
    Last modified:May 1, 1999 - v2
    Checksum:iF6416596229F2639
    GO
    Isoform 2 (identifier: Q92581-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

    Show »
    Length:701
    Mass (Da):77,917
    Checksum:iA2BE0E4EF07A62EC
    GO
    Isoform 3 (identifier: Q92581-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: Missing.
         144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

    Note: No experimental confirmation available.

    Show »
    Length:649
    Mass (Da):72,260
    Checksum:iF875E7739A25438F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti20 – 201R → G in AAH35029. (PubMed:15489334)Curated
    Sequence conflicti92 – 921K → E in BAF82464. (PubMed:14702039)Curated
    Sequence conflicti144 – 1441V → I in BAH14626. (PubMed:14702039)Curated
    Sequence conflicti307 – 3071A → T in BAH14626. (PubMed:14702039)Curated
    Sequence conflicti372 – 3721T → M in BAF82464. (PubMed:14702039)Curated
    Sequence conflicti373 – 3731E → G in BAG62192. (PubMed:14702039)Curated
    Sequence conflicti634 – 6341A → S in BAF82464. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252Missing in isoform 3. 1 PublicationVSP_044868Add
    BLAST
    Alternative sequencei144 – 1441V → VNVSGKFYEYMLKGEISSHE LNNVQDNEMLRKV in isoform 2 and isoform 3. 2 PublicationsVSP_042030

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF030409 mRNA. Translation: AAC39643.1.
    AK289775 mRNA. Translation: BAF82464.1.
    AK300475 mRNA. Translation: BAG62192.1.
    AK316255 mRNA. Translation: BAH14626.1.
    AL732579 Genomic DNA. Translation: CAI39923.1.
    AL732579 Genomic DNA. Translation: CAI39924.1.
    AL732579 Genomic DNA. Translation: CAI39925.1.
    BC035029 mRNA. Translation: AAH35029.1.
    BC049169 mRNA. Translation: AAH49169.1.
    D87743 mRNA. Translation: BAA13449.1.
    CCDSiCCDS14654.1. [Q92581-1]
    CCDS44003.1. [Q92581-2]
    CCDS55504.1. [Q92581-3]
    RefSeqiNP_001036002.1. NM_001042537.1. [Q92581-2]
    NP_001171122.1. NM_001177651.1. [Q92581-3]
    NP_006350.1. NM_006359.2. [Q92581-1]
    XP_006724789.1. XM_006724726.1. [Q92581-3]
    UniGeneiHs.62185.

    Genome annotation databases

    EnsembliENST00000370695; ENSP00000359729; ENSG00000198689. [Q92581-2]
    ENST00000370698; ENSP00000359732; ENSG00000198689. [Q92581-1]
    ENST00000370701; ENSP00000359735; ENSG00000198689. [Q92581-3]
    GeneIDi10479.
    KEGGihsa:10479.
    UCSCiuc004ezj.3. human. [Q92581-1]
    uc004ezk.3. human. [Q92581-2]
    uc011mvx.2. human.

    Polymorphism databases

    DMDMi6919937.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF030409 mRNA. Translation: AAC39643.1 .
    AK289775 mRNA. Translation: BAF82464.1 .
    AK300475 mRNA. Translation: BAG62192.1 .
    AK316255 mRNA. Translation: BAH14626.1 .
    AL732579 Genomic DNA. Translation: CAI39923.1 .
    AL732579 Genomic DNA. Translation: CAI39924.1 .
    AL732579 Genomic DNA. Translation: CAI39925.1 .
    BC035029 mRNA. Translation: AAH35029.1 .
    BC049169 mRNA. Translation: AAH49169.1 .
    D87743 mRNA. Translation: BAA13449.1 .
    CCDSi CCDS14654.1. [Q92581-1 ]
    CCDS44003.1. [Q92581-2 ]
    CCDS55504.1. [Q92581-3 ]
    RefSeqi NP_001036002.1. NM_001042537.1. [Q92581-2 ]
    NP_001171122.1. NM_001177651.1. [Q92581-3 ]
    NP_006350.1. NM_006359.2. [Q92581-1 ]
    XP_006724789.1. XM_006724726.1. [Q92581-3 ]
    UniGenei Hs.62185.

    3D structure databases

    ProteinModelPortali Q92581.
    SMRi Q92581. Positions 218-246, 337-364.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115742. 2 interactions.
    STRINGi 9606.ENSP00000359729.

    Protein family/group databases

    TCDBi 2.A.36.1.14. the monovalent cation:proton antiporter-1 (cpa1) family.

    PTM databases

    PhosphoSitei Q92581.

    Polymorphism databases

    DMDMi 6919937.

    Proteomic databases

    MaxQBi Q92581.
    PaxDbi Q92581.
    PRIDEi Q92581.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000370695 ; ENSP00000359729 ; ENSG00000198689 . [Q92581-2 ]
    ENST00000370698 ; ENSP00000359732 ; ENSG00000198689 . [Q92581-1 ]
    ENST00000370701 ; ENSP00000359735 ; ENSG00000198689 . [Q92581-3 ]
    GeneIDi 10479.
    KEGGi hsa:10479.
    UCSCi uc004ezj.3. human. [Q92581-1 ]
    uc004ezk.3. human. [Q92581-2 ]
    uc011mvx.2. human.

    Organism-specific databases

    CTDi 10479.
    GeneCardsi GC0XP135068.
    HGNCi HGNC:11079. SLC9A6.
    HPAi HPA059445.
    MIMi 300231. gene.
    300243. phenotype.
    neXtProti NX_Q92581.
    Orphaneti 85278. Christianson syndrome.
    PharmGKBi PA35935.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0025.
    HOGENOMi HOG000172307.
    HOVERGENi HBG055575.
    KOi K12041.
    OMAi DQEHLGV.
    OrthoDBi EOG7NW69D.
    PhylomeDBi Q92581.
    TreeFami TF318755.

    Enzyme and pathway databases

    Reactomei REACT_19314. Sodium/Proton exchangers.

    Miscellaneous databases

    GeneWikii SLC9A6.
    GenomeRNAii 10479.
    NextBioi 35480885.
    PROi Q92581.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q92581.
    Bgeei Q92581.
    CleanExi HS_SLC9A6.
    Genevestigatori Q92581.

    Family and domain databases

    InterProi IPR006153. Cation/H_exchanger.
    IPR018422. Cation/H_exchanger_CPA1.
    IPR002090. Na/H_exchanger_6.
    IPR004709. NaH_exchanger.
    [Graphical view ]
    PANTHERi PTHR10110. PTHR10110. 1 hit.
    Pfami PF00999. Na_H_Exchanger. 1 hit.
    [Graphical view ]
    PRINTSi PR01084. NAHEXCHNGR.
    PR01088. NAHEXCHNGR6.
    TIGRFAMsi TIGR00840. b_cpa1. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a mitochondrial Na+/H+ exchanger."
      Numata M., Petrecca K., Lake N., Orlowski J.
      J. Biol. Chem. 273:6951-6959(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Placenta.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    5. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
      Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
      DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-669 (ISOFORM 1).
      Tissue: Bone marrow.
    6. "Human Na(+)/H(+) exchanger isoform 6 is found in recycling endosomes of cells, not in mitochondria."
      Brett C.L., Wei Y., Donowitz M., Rao R.
      Am. J. Physiol. 282:C1031-C1041(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    7. "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry."
      Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.
      Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-443.
      Tissue: Mammary cancer.
    8. Cited for: INVOLVEMENT IN MRXSCH.
    9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128.
      Tissue: Liver.
    10. Cited for: INVOLVEMENT IN MRXSCH.

    Entry informationi

    Entry nameiSL9A6_HUMAN
    AccessioniPrimary (citable) accession number: Q92581
    Secondary accession number(s): A6NIQ9
    , A8K160, B4DU30, B7ZAE0, Q3ZCW7, Q5JPP8, Q5JPP9, Q86VS0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 136 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3