Q92581 (SL9A6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium/hydrogen exchanger 6 Alternative name(s): Na(+)/H(+) exchanger 6 Short name=NHE-6 Solute carrier family 9 member 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 669 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Electroneutral exchange of protons for Na+ and K+ across the early and recycling endosome membranes. Contributes to calcium homeostasis. |
| Subcellular location | Endosome membrane; Multi-pass membrane protein. Note: Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane. Ref.6 |
| Tissue specificity | Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart. |
| Involvement in disease | Mental retardation, X-linked, syndromic, Christianson type (MRXSCH) [MIM:300243]: A syndrome characterized by profound mental retardation, epilepsy, ataxia, and microcephaly. It shows phenotypic overlap with Angelman syndrome. |
| Sequence similarities | Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family. [View classification] |
| Caution | Was originally (Ref.1) identified as a mitochondrial inner membrane protein, but was later shown to be localized in early and recycling endosomes and not mitochondria (Ref.6). |
Ontologies
| Keywords | |
|---|---|
| Biological process | Antiport Ion transport Sodium transport Transport |
| Cellular component | Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Disease | Epilepsy Mental retardation |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| PTM | Glycoprotein Isopeptide bond Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of pH Inferred from electronic annotation. Source: InterPro |
| Cellular_component | early endosome membrane Inferred from direct assay Ref.6. Source: UniProtKB endoplasmic reticulum membraneInferred from direct assay PubMed 11641397. Source: UniProtKB integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from direct assay Ref.6. Source: UniProtKB recycling endosome membraneInferred from direct assay Ref.6. Source: UniProtKB |
| Molecular_function | sodium:hydrogen antiporter activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q92581-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q92581-2) The sequence of this isoform differs from the canonical sequence as follows: 144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV | ||||||
| Isoform 3 (identifier: Q92581-3) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 669 | 669 | Sodium/hydrogen exchanger 6 | PRO_0000052362 | |||||
Regions | |||||||||
| Transmembrane | 28 – 48 | 21 | Helical; Potential | ||||||
| Transmembrane | 71 – 91 | 21 | Helical; Potential | ||||||
| Transmembrane | 103 – 123 | 21 | Helical; Potential | ||||||
| Transmembrane | 142 – 162 | 21 | Helical; Potential | ||||||
| Transmembrane | 179 – 199 | 21 | Helical; Potential | ||||||
| Transmembrane | 220 – 240 | 21 | Helical; Potential | ||||||
| Transmembrane | 246 – 266 | 21 | Helical; Potential | ||||||
| Transmembrane | 292 – 312 | 21 | Helical; Potential | ||||||
| Transmembrane | 340 – 360 | 21 | Helical; Potential | ||||||
| Transmembrane | 382 – 402 | 21 | Helical; Potential | ||||||
| Transmembrane | 404 – 424 | 21 | Helical; Potential | ||||||
| Transmembrane | 447 – 467 | 21 | Helical; Potential | ||||||
| Transmembrane | 483 – 503 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 128 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||
| Cross-link | 443 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.7 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 52 | 52 | Missing in isoform 3. | VSP_044868 | |||||
| Alternative sequence | 144 | 1 | V → VNVSGKFYEYMLKGEISSHE LNNVQDNEMLRKV in isoform 2 and isoform 3. | VSP_042030 | |||||
Experimental info | |||||||||
| Sequence conflict | 20 | 1 | R → G in AAH35029. Ref.4 | ||||||
| Sequence conflict | 92 | 1 | K → E in BAF82464. Ref.2 | ||||||
| Sequence conflict | 144 | 1 | V → I in BAH14626. Ref.2 | ||||||
| Sequence conflict | 307 | 1 | A → T in BAH14626. Ref.2 | ||||||
| Sequence conflict | 372 | 1 | T → M in BAF82464. Ref.2 | ||||||
| Sequence conflict | 373 | 1 | E → G in BAG62192. Ref.2 | ||||||
| Sequence conflict | 634 | 1 | A → S in BAF82464. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a mitochondrial Na+/H+ exchanger." Numata M., Petrecca K., Lake N., Orlowski J. J. Biol. Chem. 273:6951-6959(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Placenta. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [5] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-669 (ISOFORM 1). Tissue: Bone marrow. |
| [6] | "Human Na(+)/H(+) exchanger isoform 6 is found in recycling endosomes of cells, not in mitochondria." Brett C.L., Wei Y., Donowitz M., Rao R. Am. J. Physiol. 282:C1031-C1041(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [7] | "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry." Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D. Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-443, MASS SPECTROMETRY. Tissue: Mammary cancer. |
| [8] | "SLC9A6 mutations cause X-linked mental retardation, microcephaly, epilepsy, and ataxia, a phenotype mimicking Angelman syndrome." Gilfillan G.D., Selmer K.K., Roxrud I., Smith R., Kyllerman M., Eiklid K., Kroken M., Mattingsdal M., Egeland T., Stenmark H., Sjoholm H., Server A., Samuelsson L., Christianson A., Tarpey P., Whibley A., Stratton M.R., Futreal P.A. Stromme P.Am. J. Hum. Genet. 82:1003-1010(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRXSCH. |
| [9] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF030409 mRNA. Translation: AAC39643.1. AK289775 mRNA. Translation: BAF82464.1. AK300475 mRNA. Translation: BAG62192.1. AK316255 mRNA. Translation: BAH14626.1. AL732579 Genomic DNA. Translation: CAI39923.1. AL732579 Genomic DNA. Translation: CAI39924.1. AL732579 Genomic DNA. Translation: CAI39925.1. BC035029 mRNA. Translation: AAH35029.1. BC049169 mRNA. Translation: AAH49169.1. D87743 mRNA. Translation: BAA13449.1. |
| IPI | IPI00022061. IPI00647658. |
| RefSeq | NP_001036002.1. NM_001042537.1. NP_001171122.1. NM_001177651.1. NP_006350.1. NM_006359.2. |
| UniGene | Hs.62185. |
3D structure databases | |
| ProteinModelPortal | Q92581. |
| SMR | Q92581. Positions 218-246. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000359729. |
PTM databases | |
| PhosphoSite | Q92581. |
Polymorphism databases | |
| DMDM | 6919937. |
Proteomic databases | |
| PaxDb | Q92581. |
| PRIDE | Q92581. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370695; ENSP00000359729; ENSG00000198689. ENST00000370698; ENSP00000359732; ENSG00000198689. ENST00000370701; ENSP00000359735; ENSG00000198689. ENST00000595850; ENSP00000470998; ENSG00000269036. ENST00000595964; ENSP00000471427; ENSG00000269036. ENST00000597470; ENSP00000470918; ENSG00000269036. |
| GeneID | 10479. |
| KEGG | hsa:10479. |
| UCSC | uc004ezj.3. human. |
Organism-specific databases | |
| CTD | 10479. |
| GeneCards | GC0XP135068. |
| HGNC | HGNC:11079. SLC9A6. |
| MIM | 300231. gene. 300243. phenotype. |
| neXtProt | NX_Q92581. |
| Orphanet | 85278. X-linked intellectual deficit, South African type. |
| PharmGKB | PA35935. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0025. |
| HOGENOM | HOG000172307. |
| HOVERGEN | HBG055575. |
| KO | K12041. |
| OMA | DQEHLGV. |
| PhylomeDB | Q92581. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q92581. |
| Bgee | Q92581. |
| CleanEx | HS_SLC9A6. |
| Genevestigator | Q92581. |
| GermOnline | ENSG00000198689. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006153. Cation/H_exchanger. IPR018422. Cation/H_exchanger_CPA1. IPR002090. Na/H_exchanger_6. IPR004709. NaH_exchanger. [Graphical view] |
| PANTHER | PTHR10110. PTHR10110. 1 hit. |
| Pfam | PF00999. Na_H_Exchanger. 1 hit. [Graphical view] |
| PRINTS | PR01084. NAHEXCHNGR. PR01088. NAHEXCHNGR6. |
| TIGRFAMs | TIGR00840. b_cpa1. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10479. |
| NextBio | 35480885. |
| SOURCE | Search... |
Entry information
| Entry name | SL9A6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q92581 Secondary accession number(s): A6NIQ9 Q86VS0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
