SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92581

- SL9A6_HUMAN

UniProt

Q92581 - SL9A6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sodium/hydrogen exchanger 6
Gene
SLC9A6, KIAA0267, NHE6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Electroneutral exchange of protons for Na+ and K+ across the early and recycling endosome membranes. Contributes to calcium homeostasis.

GO - Molecular functioni

  1. sodium:proton antiporter activity Source: ProtInc

GO - Biological processi

  1. axon extension Source: MGI
  2. dendrite extension Source: MGI
  3. ion transport Source: Reactome
  4. neuron projection morphogenesis Source: MGI
  5. regulation of pH Source: InterPro
  6. sodium ion transmembrane transport Source: GOC
  7. transmembrane transport Source: Reactome
  8. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Antiport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_19314. Sodium/Proton exchangers.

Protein family/group databases

TCDBi2.A.36.1.14. the monovalent cation:proton antiporter-1 (cpa1) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/hydrogen exchanger 6
Alternative name(s):
Na(+)/H(+) exchanger 6
Short name:
NHE-6
Solute carrier family 9 member 6
Gene namesi
Name:SLC9A6
Synonyms:KIAA0267, NHE6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:11079. SLC9A6.

Subcellular locationi

Endosome membrane; Multi-pass membrane protein
Note: Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei28 – 4821Helical; Reviewed prediction
Add
BLAST
Transmembranei71 – 9121Helical; Reviewed prediction
Add
BLAST
Transmembranei103 – 12321Helical; Reviewed prediction
Add
BLAST
Transmembranei142 – 16221Helical; Reviewed prediction
Add
BLAST
Transmembranei179 – 19921Helical; Reviewed prediction
Add
BLAST
Transmembranei220 – 24021Helical; Reviewed prediction
Add
BLAST
Transmembranei246 – 26621Helical; Reviewed prediction
Add
BLAST
Transmembranei292 – 31221Helical; Reviewed prediction
Add
BLAST
Transmembranei340 – 36021Helical; Reviewed prediction
Add
BLAST
Transmembranei382 – 40221Helical; Reviewed prediction
Add
BLAST
Transmembranei404 – 42421Helical; Reviewed prediction
Add
BLAST
Transmembranei447 – 46721Helical; Reviewed prediction
Add
BLAST
Transmembranei483 – 50321Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. early endosome membrane Source: UniProtKB
  2. endoplasmic reticulum membrane Source: UniProtKB
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB
  5. recycling endosome membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

Pathology & Biotechi

Involvement in diseasei

Mental retardation, X-linked, syndromic, Christianson type (MRXSCH) [MIM:300243]: A syndrome characterized by profound mental retardation, epilepsy, ataxia, and microcephaly. It shows phenotypic overlap with Angelman syndrome.
Note: The disease is caused by mutations affecting the gene represented in this entry.2 Publications

Keywords - Diseasei

Epilepsy, Mental retardation

Organism-specific databases

MIMi300243. phenotype.
Orphaneti85278. Christianson syndrome.
PharmGKBiPA35935.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 669669Sodium/hydrogen exchanger 6
PRO_0000052362Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi128 – 1281N-linked (GlcNAc...)1 Publication
Cross-linki443 – 443Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Keywords - PTMi

Glycoprotein, Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ92581.
PaxDbiQ92581.
PRIDEiQ92581.

PTM databases

PhosphoSiteiQ92581.

Expressioni

Tissue specificityi

Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.

Gene expression databases

ArrayExpressiQ92581.
BgeeiQ92581.
CleanExiHS_SLC9A6.
GenevestigatoriQ92581.

Organism-specific databases

HPAiHPA059445.

Interactioni

Protein-protein interaction databases

BioGridi115742. 2 interactions.
STRINGi9606.ENSP00000359729.

Structurei

3D structure databases

ProteinModelPortaliQ92581.
SMRiQ92581. Positions 218-246, 337-364.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0025.
HOGENOMiHOG000172307.
HOVERGENiHBG055575.
KOiK12041.
OMAiDQEHLGV.
OrthoDBiEOG7NW69D.
PhylomeDBiQ92581.
TreeFamiTF318755.

Family and domain databases

InterProiIPR006153. Cation/H_exchanger.
IPR018422. Cation/H_exchanger_CPA1.
IPR002090. Na/H_exchanger_6.
IPR004709. NaH_exchanger.
[Graphical view]
PANTHERiPTHR10110. PTHR10110. 1 hit.
PfamiPF00999. Na_H_Exchanger. 1 hit.
[Graphical view]
PRINTSiPR01084. NAHEXCHNGR.
PR01088. NAHEXCHNGR6.
TIGRFAMsiTIGR00840. b_cpa1. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92581-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MARRGWRRAP LRRGVGSSPR ARRLMRPLWL LLAVGVFDWA GASDGGGGEA    50
RAMDEEIVSE KQAEESHRQD SANLLIFILL LTLTILTIWL FKHRRARFLH 100
ETGLAMIYGL LVGLVLRYGI HVPSDVNNVT LSCEVQSSPT TLLVTFDPEV 150
FFNILLPPII FYAGYSLKRR HFFRNLGSIL AYAFLGTAIS CFVIGSIMYG 200
CVTLMKVTGQ LAGDFYFTDC LLFGAIVSAT DPVTVLAIFH ELQVDVELYA 250
LLFGESVLND AVAIVLSSSI VAYQPAGDNS HTFDVTAMFK SIGIFLGIFS 300
GSFAMGAATG VVTALVTKFT KLREFQLLET GLFFLMSWST FLLAEAWGFT 350
GVVAVLFCGI TQAHYTYNNL STESQHRTKQ LFELLNFLAE NFIFSYMGLT 400
LFTFQNHVFN PTFVVGAFVA IFLGRAANIY PLSLLLNLGR RSKIGSNFQH 450
MMMFAGLRGA MAFALAIRDT ATYARQMMFS TTLLIVFFTV WVFGGGTTAM 500
LSCLHIRVGV DSDQEHLGVP ENERRTTKAE SAWLFRMWYN FDHNYLKPLL 550
THSGPPLTTT LPACCGPIAR CLTSPQAYEN QEQLKDDDSD LILNDGDISL 600
TYGDSTVNTE PATSSAPRRF MGNSSEDALD RELAFGDHEL VIRGTRLVLP 650
MDDSEPPLNL LDNTRHGPA 669
Length:669
Mass (Da):74,162
Last modified:May 1, 1999 - v2
Checksum:iF6416596229F2639
GO
Isoform 2 (identifier: Q92581-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

Show »
Length:701
Mass (Da):77,917
Checksum:iA2BE0E4EF07A62EC
GO
Isoform 3 (identifier: Q92581-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

Note: No experimental confirmation available.

Show »
Length:649
Mass (Da):72,260
Checksum:iF875E7739A25438F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252Missing in isoform 3.
VSP_044868Add
BLAST
Alternative sequencei144 – 1441V → VNVSGKFYEYMLKGEISSHE LNNVQDNEMLRKV in isoform 2 and isoform 3.
VSP_042030

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201R → G in AAH35029. 1 Publication
Sequence conflicti92 – 921K → E in BAF82464. 1 Publication
Sequence conflicti144 – 1441V → I in BAH14626. 1 Publication
Sequence conflicti307 – 3071A → T in BAH14626. 1 Publication
Sequence conflicti372 – 3721T → M in BAF82464. 1 Publication
Sequence conflicti373 – 3731E → G in BAG62192. 1 Publication
Sequence conflicti634 – 6341A → S in BAF82464. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF030409 mRNA. Translation: AAC39643.1.
AK289775 mRNA. Translation: BAF82464.1.
AK300475 mRNA. Translation: BAG62192.1.
AK316255 mRNA. Translation: BAH14626.1.
AL732579 Genomic DNA. Translation: CAI39923.1.
AL732579 Genomic DNA. Translation: CAI39924.1.
AL732579 Genomic DNA. Translation: CAI39925.1.
BC035029 mRNA. Translation: AAH35029.1.
BC049169 mRNA. Translation: AAH49169.1.
D87743 mRNA. Translation: BAA13449.1.
CCDSiCCDS14654.1. [Q92581-1]
CCDS44003.1. [Q92581-2]
CCDS55504.1. [Q92581-3]
RefSeqiNP_001036002.1. NM_001042537.1. [Q92581-2]
NP_001171122.1. NM_001177651.1. [Q92581-3]
NP_006350.1. NM_006359.2. [Q92581-1]
XP_006724789.1. XM_006724726.1. [Q92581-3]
UniGeneiHs.62185.

Genome annotation databases

EnsembliENST00000370695; ENSP00000359729; ENSG00000198689. [Q92581-2]
ENST00000370698; ENSP00000359732; ENSG00000198689. [Q92581-1]
ENST00000370701; ENSP00000359735; ENSG00000198689. [Q92581-3]
ENST00000595850; ENSP00000470998; ENSG00000269036. [Q92581-3]
ENST00000595964; ENSP00000471427; ENSG00000269036. [Q92581-2]
ENST00000597470; ENSP00000470918; ENSG00000269036. [Q92581-1]
GeneIDi10479.
KEGGihsa:10479.
UCSCiuc004ezj.3. human. [Q92581-1]
uc004ezk.3. human. [Q92581-2]
uc011mvx.2. human.

Polymorphism databases

DMDMi6919937.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF030409 mRNA. Translation: AAC39643.1 .
AK289775 mRNA. Translation: BAF82464.1 .
AK300475 mRNA. Translation: BAG62192.1 .
AK316255 mRNA. Translation: BAH14626.1 .
AL732579 Genomic DNA. Translation: CAI39923.1 .
AL732579 Genomic DNA. Translation: CAI39924.1 .
AL732579 Genomic DNA. Translation: CAI39925.1 .
BC035029 mRNA. Translation: AAH35029.1 .
BC049169 mRNA. Translation: AAH49169.1 .
D87743 mRNA. Translation: BAA13449.1 .
CCDSi CCDS14654.1. [Q92581-1 ]
CCDS44003.1. [Q92581-2 ]
CCDS55504.1. [Q92581-3 ]
RefSeqi NP_001036002.1. NM_001042537.1. [Q92581-2 ]
NP_001171122.1. NM_001177651.1. [Q92581-3 ]
NP_006350.1. NM_006359.2. [Q92581-1 ]
XP_006724789.1. XM_006724726.1. [Q92581-3 ]
UniGenei Hs.62185.

3D structure databases

ProteinModelPortali Q92581.
SMRi Q92581. Positions 218-246, 337-364.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115742. 2 interactions.
STRINGi 9606.ENSP00000359729.

Protein family/group databases

TCDBi 2.A.36.1.14. the monovalent cation:proton antiporter-1 (cpa1) family.

PTM databases

PhosphoSitei Q92581.

Polymorphism databases

DMDMi 6919937.

Proteomic databases

MaxQBi Q92581.
PaxDbi Q92581.
PRIDEi Q92581.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000370695 ; ENSP00000359729 ; ENSG00000198689 . [Q92581-2 ]
ENST00000370698 ; ENSP00000359732 ; ENSG00000198689 . [Q92581-1 ]
ENST00000370701 ; ENSP00000359735 ; ENSG00000198689 . [Q92581-3 ]
ENST00000595850 ; ENSP00000470998 ; ENSG00000269036 . [Q92581-3 ]
ENST00000595964 ; ENSP00000471427 ; ENSG00000269036 . [Q92581-2 ]
ENST00000597470 ; ENSP00000470918 ; ENSG00000269036 . [Q92581-1 ]
GeneIDi 10479.
KEGGi hsa:10479.
UCSCi uc004ezj.3. human. [Q92581-1 ]
uc004ezk.3. human. [Q92581-2 ]
uc011mvx.2. human.

Organism-specific databases

CTDi 10479.
GeneCardsi GC0XP135068.
HGNCi HGNC:11079. SLC9A6.
HPAi HPA059445.
MIMi 300231. gene.
300243. phenotype.
neXtProti NX_Q92581.
Orphaneti 85278. Christianson syndrome.
PharmGKBi PA35935.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0025.
HOGENOMi HOG000172307.
HOVERGENi HBG055575.
KOi K12041.
OMAi DQEHLGV.
OrthoDBi EOG7NW69D.
PhylomeDBi Q92581.
TreeFami TF318755.

Enzyme and pathway databases

Reactomei REACT_19314. Sodium/Proton exchangers.

Miscellaneous databases

GeneWikii SLC9A6.
GenomeRNAii 10479.
NextBioi 35480885.
PROi Q92581.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q92581.
Bgeei Q92581.
CleanExi HS_SLC9A6.
Genevestigatori Q92581.

Family and domain databases

InterProi IPR006153. Cation/H_exchanger.
IPR018422. Cation/H_exchanger_CPA1.
IPR002090. Na/H_exchanger_6.
IPR004709. NaH_exchanger.
[Graphical view ]
PANTHERi PTHR10110. PTHR10110. 1 hit.
Pfami PF00999. Na_H_Exchanger. 1 hit.
[Graphical view ]
PRINTSi PR01084. NAHEXCHNGR.
PR01088. NAHEXCHNGR6.
TIGRFAMsi TIGR00840. b_cpa1. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a mitochondrial Na+/H+ exchanger."
    Numata M., Petrecca K., Lake N., Orlowski J.
    J. Biol. Chem. 273:6951-6959(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Placenta.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-669 (ISOFORM 1).
    Tissue: Bone marrow.
  6. "Human Na(+)/H(+) exchanger isoform 6 is found in recycling endosomes of cells, not in mitochondria."
    Brett C.L., Wei Y., Donowitz M., Rao R.
    Am. J. Physiol. 282:C1031-C1041(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  7. "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry."
    Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.
    Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-443.
    Tissue: Mammary cancer.
  8. Cited for: INVOLVEMENT IN MRXSCH.
  9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128.
    Tissue: Liver.
  10. Cited for: INVOLVEMENT IN MRXSCH.

Entry informationi

Entry nameiSL9A6_HUMAN
AccessioniPrimary (citable) accession number: Q92581
Secondary accession number(s): A6NIQ9
, A8K160, B4DU30, B7ZAE0, Q3ZCW7, Q5JPP8, Q5JPP9, Q86VS0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: September 3, 2014
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi