Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q92564

- DCNL4_HUMAN

UniProt

Q92564 - DCNL4_HUMAN

Protein

DCN1-like protein 4

Gene

DCUN1D4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (25 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DCN1-like protein 4
    Alternative name(s):
    DCUN1 domain-containing protein 4
    Defective in cullin neddylation protein 1-like protein 4
    Gene namesi
    Name:DCUN1D4
    Synonyms:KIAA0276
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:28998. DCUN1D4.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: LIFEdb

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672010.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 292292DCN1-like protein 4PRO_0000129503Add
    BLAST

    Proteomic databases

    MaxQBiQ92564.
    PaxDbiQ92564.
    PRIDEiQ92564.

    Expressioni

    Gene expression databases

    ArrayExpressiQ92564.
    BgeeiQ92564.
    CleanExiHS_DCUN1D4.
    GenevestigatoriQ92564.

    Organism-specific databases

    HPAiHPA036483.
    HPA036484.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    P299913EBI-2654610,EBI-8826488From a different organism.

    Protein-protein interaction databases

    BioGridi116759. 9 interactions.
    IntActiQ92564. 2 interactions.
    MINTiMINT-4720144.
    STRINGi9606.ENSP00000334625.

    Structurei

    3D structure databases

    ProteinModelPortaliQ92564.
    SMRiQ92564. Positions 104-287.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini101 – 287187DCUN1PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 DCUN1 domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG279481.
    HOGENOMiHOG000241761.
    HOVERGENiHBG106637.
    InParanoidiQ92564.
    KOiK17824.
    PhylomeDBiQ92564.
    TreeFamiTF354270.

    Family and domain databases

    InterProiIPR014764. DCN-prot.
    IPR005176. PONY_dom.
    [Graphical view]
    PANTHERiPTHR12281. PTHR12281. 1 hit.
    PfamiPF03556. Cullin_binding. 1 hit.
    [Graphical view]
    PROSITEiPS51229. DCUN1. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q92564-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHSDAAAVNF QLNSHLSTLA NIHKIYHTLN KLNLTEDIGQ DDHQTGSLRS    50
    CSSSDCFNKV MPPRKKRRPA SGDDLSAKKS RHDSMYRKYD STRIKTEEEA 100
    FSSKRCLEWF YEYAGTDDVV GPEGMEKFCE DIGVEPENVV MLVLAWKLDA 150
    QNMGYFTLQE WLKGMTSLQC DTTEKLRNTL DYLRSFLNDS TNFKLIYRYA 200
    FDFAREKDQR SLDINTAKCM LGLLLGKIWP LFPVFHQFLE QSKYKVINKD 250
    QWCNVLEFSR TINLDLSNYD EDGAWPVLLD EFVEWYKDKQ MS 292
    Length:292
    Mass (Da):34,068
    Last modified:October 25, 2005 - v2
    Checksum:i1927AA612E075E9C
    GO
    Isoform 2 (identifier: Q92564-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         206-240: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:257
    Mass (Da):29,984
    Checksum:i0090D4A1D4E7314C
    GO
    Isoform 3 (identifier: Q92564-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-9: MHSDAAAVN → MEVEAALGCSGQGRGCGGVAPAGRGRERASERGTRVRISKGLSGAGGSVRKAD

    Note: No experimental confirmation available.

    Show »
    Length:336
    Mass (Da):38,382
    Checksum:iB1ABCAA676927798
    GO

    Sequence cautioni

    The sequence BAA13405.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD97912.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 99MHSDAAAVN → MEVEAALGCSGQGRGCGGVA PAGRGRERASERGTRVRISK GLSGAGGSVRKAD in isoform 3. 1 PublicationVSP_054381
    Alternative sequencei206 – 24035Missing in isoform 2. 1 PublicationVSP_016016Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D87466 mRNA. Translation: BAA13405.1. Different initiation.
    AK294894 mRNA. Translation: BAG57986.1.
    BX537944 mRNA. Translation: CAD97912.1. Different initiation.
    AC027271 Genomic DNA. No translation available.
    BC053897 mRNA. Translation: AAH53897.2.
    CCDSiCCDS33982.1. [Q92564-1]
    CCDS3487.2. [Q92564-2]
    RefSeqiNP_001035492.1. NM_001040402.2. [Q92564-1]
    NP_001274684.1. NM_001287755.1. [Q92564-3]
    NP_001274686.1. NM_001287757.1.
    NP_055930.2. NM_015115.3. [Q92564-2]
    UniGeneiHs.605388.

    Genome annotation databases

    EnsembliENST00000334635; ENSP00000334625; ENSG00000109184. [Q92564-1]
    ENST00000381441; ENSP00000370850; ENSG00000109184. [Q92564-2]
    ENST00000451288; ENSP00000389900; ENSG00000109184. [Q92564-3]
    GeneIDi23142.
    KEGGihsa:23142.
    UCSCiuc003gze.3. human. [Q92564-1]
    uc003gzf.3. human. [Q92564-2]

    Polymorphism databases

    DMDMi78099237.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D87466 mRNA. Translation: BAA13405.1 . Different initiation.
    AK294894 mRNA. Translation: BAG57986.1 .
    BX537944 mRNA. Translation: CAD97912.1 . Different initiation.
    AC027271 Genomic DNA. No translation available.
    BC053897 mRNA. Translation: AAH53897.2 .
    CCDSi CCDS33982.1. [Q92564-1 ]
    CCDS3487.2. [Q92564-2 ]
    RefSeqi NP_001035492.1. NM_001040402.2. [Q92564-1 ]
    NP_001274684.1. NM_001287755.1. [Q92564-3 ]
    NP_001274686.1. NM_001287757.1.
    NP_055930.2. NM_015115.3. [Q92564-2 ]
    UniGenei Hs.605388.

    3D structure databases

    ProteinModelPortali Q92564.
    SMRi Q92564. Positions 104-287.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116759. 9 interactions.
    IntActi Q92564. 2 interactions.
    MINTi MINT-4720144.
    STRINGi 9606.ENSP00000334625.

    Polymorphism databases

    DMDMi 78099237.

    Proteomic databases

    MaxQBi Q92564.
    PaxDbi Q92564.
    PRIDEi Q92564.

    Protocols and materials databases

    DNASUi 23142.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000334635 ; ENSP00000334625 ; ENSG00000109184 . [Q92564-1 ]
    ENST00000381441 ; ENSP00000370850 ; ENSG00000109184 . [Q92564-2 ]
    ENST00000451288 ; ENSP00000389900 ; ENSG00000109184 . [Q92564-3 ]
    GeneIDi 23142.
    KEGGi hsa:23142.
    UCSCi uc003gze.3. human. [Q92564-1 ]
    uc003gzf.3. human. [Q92564-2 ]

    Organism-specific databases

    CTDi 23142.
    GeneCardsi GC04P052709.
    HGNCi HGNC:28998. DCUN1D4.
    HPAi HPA036483.
    HPA036484.
    MIMi 612977. gene.
    neXtProti NX_Q92564.
    PharmGKBi PA142672010.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG279481.
    HOGENOMi HOG000241761.
    HOVERGENi HBG106637.
    InParanoidi Q92564.
    KOi K17824.
    PhylomeDBi Q92564.
    TreeFami TF354270.

    Miscellaneous databases

    ChiTaRSi DCUN1D4. human.
    GeneWikii DCUN1D4.
    GenomeRNAii 23142.
    NextBioi 35471903.
    PROi Q92564.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q92564.
    Bgeei Q92564.
    CleanExi HS_DCUN1D4.
    Genevestigatori Q92564.

    Family and domain databases

    InterProi IPR014764. DCN-prot.
    IPR005176. PONY_dom.
    [Graphical view ]
    PANTHERi PTHR12281. PTHR12281. 1 hit.
    Pfami PF03556. Cullin_binding. 1 hit.
    [Graphical view ]
    PROSITEi PS51229. DCUN1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
      Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
      DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Retina.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Uterus.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiDCNL4_HUMAN
    AccessioniPrimary (citable) accession number: Q92564
    Secondary accession number(s): B4DH25, Q7Z3F3, Q7Z6B8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: October 25, 2005
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3