Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DCN1-like protein 4

Gene

DCUN1D4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
DCN1-like protein 4
Alternative name(s):
DCUN1 domain-containing protein 4
Defective in cullin neddylation protein 1-like protein 4
Gene namesi
Name:DCUN1D4
Synonyms:KIAA0276
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:28998. DCUN1D4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672010.

Polymorphism and mutation databases

DMDMi78099237.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 292292DCN1-like protein 4PRO_0000129503Add
BLAST

Proteomic databases

MaxQBiQ92564.
PaxDbiQ92564.
PRIDEiQ92564.

Expressioni

Gene expression databases

BgeeiQ92564.
CleanExiHS_DCUN1D4.
ExpressionAtlasiQ92564. baseline and differential.
GenevisibleiQ92564. HS.

Organism-specific databases

HPAiHPA036483.
HPA036484.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
P299913EBI-2654610,EBI-8826488From a different organism.

Protein-protein interaction databases

BioGridi116759. 12 interactions.
IntActiQ92564. 2 interactions.
MINTiMINT-4720144.
STRINGi9606.ENSP00000334625.

Structurei

3D structure databases

ProteinModelPortaliQ92564.
SMRiQ92564. Positions 104-287.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini101 – 287187DCUN1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 DCUN1 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG279481.
GeneTreeiENSGT00550000074529.
HOGENOMiHOG000241761.
HOVERGENiHBG106637.
InParanoidiQ92564.
KOiK17824.
OMAiPVFNQFL.
PhylomeDBiQ92564.
TreeFamiTF354270.

Family and domain databases

InterProiIPR014764. DCN-prot.
IPR005176. PONY_dom.
[Graphical view]
PANTHERiPTHR12281. PTHR12281. 1 hit.
PfamiPF03556. Cullin_binding. 1 hit.
[Graphical view]
PROSITEiPS51229. DCUN1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q92564-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHSDAAAVNF QLNSHLSTLA NIHKIYHTLN KLNLTEDIGQ DDHQTGSLRS
60 70 80 90 100
CSSSDCFNKV MPPRKKRRPA SGDDLSAKKS RHDSMYRKYD STRIKTEEEA
110 120 130 140 150
FSSKRCLEWF YEYAGTDDVV GPEGMEKFCE DIGVEPENVV MLVLAWKLDA
160 170 180 190 200
QNMGYFTLQE WLKGMTSLQC DTTEKLRNTL DYLRSFLNDS TNFKLIYRYA
210 220 230 240 250
FDFAREKDQR SLDINTAKCM LGLLLGKIWP LFPVFHQFLE QSKYKVINKD
260 270 280 290
QWCNVLEFSR TINLDLSNYD EDGAWPVLLD EFVEWYKDKQ MS
Length:292
Mass (Da):34,068
Last modified:October 25, 2005 - v2
Checksum:i1927AA612E075E9C
GO
Isoform 2 (identifier: Q92564-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     206-240: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):29,984
Checksum:i0090D4A1D4E7314C
GO
Isoform 3 (identifier: Q92564-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MHSDAAAVN → MEVEAALGCSGQGRGCGGVAPAGRGRERASERGTRVRISKGLSGAGGSVRKAD

Note: No experimental confirmation available.
Show »
Length:336
Mass (Da):38,382
Checksum:iB1ABCAA676927798
GO

Sequence cautioni

The sequence BAA13405.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAD97912.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 99MHSDAAAVN → MEVEAALGCSGQGRGCGGVA PAGRGRERASERGTRVRISK GLSGAGGSVRKAD in isoform 3. 1 PublicationVSP_054381
Alternative sequencei206 – 24035Missing in isoform 2. 1 PublicationVSP_016016Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA. Translation: BAA13405.1. Different initiation.
AK294894 mRNA. Translation: BAG57986.1.
BX537944 mRNA. Translation: CAD97912.1. Different initiation.
AC027271 Genomic DNA. No translation available.
BC053897 mRNA. Translation: AAH53897.2.
CCDSiCCDS33982.1. [Q92564-1]
CCDS3487.2. [Q92564-2]
CCDS75123.1. [Q92564-3]
RefSeqiNP_001035492.1. NM_001040402.2. [Q92564-1]
NP_001274684.1. NM_001287755.1. [Q92564-3]
NP_001274686.1. NM_001287757.1.
NP_055930.2. NM_015115.3. [Q92564-2]
UniGeneiHs.605388.

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184. [Q92564-1]
ENST00000381441; ENSP00000370850; ENSG00000109184. [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184. [Q92564-3]
GeneIDi23142.
KEGGihsa:23142.
UCSCiuc003gze.3. human. [Q92564-1]
uc003gzf.3. human. [Q92564-2]
uc011bzo.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA. Translation: BAA13405.1. Different initiation.
AK294894 mRNA. Translation: BAG57986.1.
BX537944 mRNA. Translation: CAD97912.1. Different initiation.
AC027271 Genomic DNA. No translation available.
BC053897 mRNA. Translation: AAH53897.2.
CCDSiCCDS33982.1. [Q92564-1]
CCDS3487.2. [Q92564-2]
CCDS75123.1. [Q92564-3]
RefSeqiNP_001035492.1. NM_001040402.2. [Q92564-1]
NP_001274684.1. NM_001287755.1. [Q92564-3]
NP_001274686.1. NM_001287757.1.
NP_055930.2. NM_015115.3. [Q92564-2]
UniGeneiHs.605388.

3D structure databases

ProteinModelPortaliQ92564.
SMRiQ92564. Positions 104-287.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116759. 12 interactions.
IntActiQ92564. 2 interactions.
MINTiMINT-4720144.
STRINGi9606.ENSP00000334625.

Polymorphism and mutation databases

DMDMi78099237.

Proteomic databases

MaxQBiQ92564.
PaxDbiQ92564.
PRIDEiQ92564.

Protocols and materials databases

DNASUi23142.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184. [Q92564-1]
ENST00000381441; ENSP00000370850; ENSG00000109184. [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184. [Q92564-3]
GeneIDi23142.
KEGGihsa:23142.
UCSCiuc003gze.3. human. [Q92564-1]
uc003gzf.3. human. [Q92564-2]
uc011bzo.2. human.

Organism-specific databases

CTDi23142.
GeneCardsiGC04P052709.
HGNCiHGNC:28998. DCUN1D4.
HPAiHPA036483.
HPA036484.
MIMi612977. gene.
neXtProtiNX_Q92564.
PharmGKBiPA142672010.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG279481.
GeneTreeiENSGT00550000074529.
HOGENOMiHOG000241761.
HOVERGENiHBG106637.
InParanoidiQ92564.
KOiK17824.
OMAiPVFNQFL.
PhylomeDBiQ92564.
TreeFamiTF354270.

Miscellaneous databases

ChiTaRSiDCUN1D4. human.
GeneWikiiDCUN1D4.
GenomeRNAii23142.
NextBioi35471903.
PROiQ92564.
SOURCEiSearch...

Gene expression databases

BgeeiQ92564.
CleanExiHS_DCUN1D4.
ExpressionAtlasiQ92564. baseline and differential.
GenevisibleiQ92564. HS.

Family and domain databases

InterProiIPR014764. DCN-prot.
IPR005176. PONY_dom.
[Graphical view]
PANTHERiPTHR12281. PTHR12281. 1 hit.
PfamiPF03556. Cullin_binding. 1 hit.
[Graphical view]
PROSITEiPS51229. DCUN1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Retina.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDCNL4_HUMAN
AccessioniPrimary (citable) accession number: Q92564
Secondary accession number(s): B4DH25, Q7Z3F3, Q7Z6B8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: June 24, 2015
This is version 110 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.