Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q92564

- DCNL4_HUMAN

UniProt

Q92564 - DCNL4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DCN1-like protein 4

Gene

DCUN1D4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
DCN1-like protein 4
Alternative name(s):
DCUN1 domain-containing protein 4
Defective in cullin neddylation protein 1-like protein 4
Gene namesi
Name:DCUN1D4
Synonyms:KIAA0276
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:28998. DCUN1D4.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: LIFEdb
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672010.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 292292DCN1-like protein 4PRO_0000129503Add
BLAST

Proteomic databases

MaxQBiQ92564.
PaxDbiQ92564.
PRIDEiQ92564.

Expressioni

Gene expression databases

BgeeiQ92564.
CleanExiHS_DCUN1D4.
ExpressionAtlasiQ92564. baseline and differential.
GenevestigatoriQ92564.

Organism-specific databases

HPAiHPA036483.
HPA036484.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
P299913EBI-2654610,EBI-8826488From a different organism.

Protein-protein interaction databases

BioGridi116759. 9 interactions.
IntActiQ92564. 2 interactions.
MINTiMINT-4720144.
STRINGi9606.ENSP00000334625.

Structurei

3D structure databases

ProteinModelPortaliQ92564.
SMRiQ92564. Positions 104-287.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini101 – 287187DCUN1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 DCUN1 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG279481.
GeneTreeiENSGT00550000074529.
HOGENOMiHOG000241761.
HOVERGENiHBG106637.
InParanoidiQ92564.
KOiK17824.
PhylomeDBiQ92564.
TreeFamiTF354270.

Family and domain databases

InterProiIPR014764. DCN-prot.
IPR005176. PONY_dom.
[Graphical view]
PANTHERiPTHR12281. PTHR12281. 1 hit.
PfamiPF03556. Cullin_binding. 1 hit.
[Graphical view]
PROSITEiPS51229. DCUN1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q92564-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHSDAAAVNF QLNSHLSTLA NIHKIYHTLN KLNLTEDIGQ DDHQTGSLRS
60 70 80 90 100
CSSSDCFNKV MPPRKKRRPA SGDDLSAKKS RHDSMYRKYD STRIKTEEEA
110 120 130 140 150
FSSKRCLEWF YEYAGTDDVV GPEGMEKFCE DIGVEPENVV MLVLAWKLDA
160 170 180 190 200
QNMGYFTLQE WLKGMTSLQC DTTEKLRNTL DYLRSFLNDS TNFKLIYRYA
210 220 230 240 250
FDFAREKDQR SLDINTAKCM LGLLLGKIWP LFPVFHQFLE QSKYKVINKD
260 270 280 290
QWCNVLEFSR TINLDLSNYD EDGAWPVLLD EFVEWYKDKQ MS
Length:292
Mass (Da):34,068
Last modified:October 25, 2005 - v2
Checksum:i1927AA612E075E9C
GO
Isoform 2 (identifier: Q92564-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     206-240: Missing.

Note: No experimental confirmation available.

Show »
Length:257
Mass (Da):29,984
Checksum:i0090D4A1D4E7314C
GO
Isoform 3 (identifier: Q92564-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MHSDAAAVN → MEVEAALGCSGQGRGCGGVAPAGRGRERASERGTRVRISKGLSGAGGSVRKAD

Note: No experimental confirmation available.

Show »
Length:336
Mass (Da):38,382
Checksum:iB1ABCAA676927798
GO

Sequence cautioni

The sequence BAA13405.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAD97912.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 99MHSDAAAVN → MEVEAALGCSGQGRGCGGVA PAGRGRERASERGTRVRISK GLSGAGGSVRKAD in isoform 3. 1 PublicationVSP_054381
Alternative sequencei206 – 24035Missing in isoform 2. 1 PublicationVSP_016016Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA. Translation: BAA13405.1. Different initiation.
AK294894 mRNA. Translation: BAG57986.1.
BX537944 mRNA. Translation: CAD97912.1. Different initiation.
AC027271 Genomic DNA. No translation available.
BC053897 mRNA. Translation: AAH53897.2.
CCDSiCCDS33982.1. [Q92564-1]
CCDS3487.2. [Q92564-2]
CCDS75123.1. [Q92564-3]
RefSeqiNP_001035492.1. NM_001040402.2. [Q92564-1]
NP_001274684.1. NM_001287755.1. [Q92564-3]
NP_001274686.1. NM_001287757.1.
NP_055930.2. NM_015115.3. [Q92564-2]
UniGeneiHs.605388.

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184. [Q92564-1]
ENST00000381441; ENSP00000370850; ENSG00000109184. [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184. [Q92564-3]
GeneIDi23142.
KEGGihsa:23142.
UCSCiuc003gze.3. human. [Q92564-1]
uc003gzf.3. human. [Q92564-2]

Polymorphism databases

DMDMi78099237.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA. Translation: BAA13405.1 . Different initiation.
AK294894 mRNA. Translation: BAG57986.1 .
BX537944 mRNA. Translation: CAD97912.1 . Different initiation.
AC027271 Genomic DNA. No translation available.
BC053897 mRNA. Translation: AAH53897.2 .
CCDSi CCDS33982.1. [Q92564-1 ]
CCDS3487.2. [Q92564-2 ]
CCDS75123.1. [Q92564-3 ]
RefSeqi NP_001035492.1. NM_001040402.2. [Q92564-1 ]
NP_001274684.1. NM_001287755.1. [Q92564-3 ]
NP_001274686.1. NM_001287757.1.
NP_055930.2. NM_015115.3. [Q92564-2 ]
UniGenei Hs.605388.

3D structure databases

ProteinModelPortali Q92564.
SMRi Q92564. Positions 104-287.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116759. 9 interactions.
IntActi Q92564. 2 interactions.
MINTi MINT-4720144.
STRINGi 9606.ENSP00000334625.

Polymorphism databases

DMDMi 78099237.

Proteomic databases

MaxQBi Q92564.
PaxDbi Q92564.
PRIDEi Q92564.

Protocols and materials databases

DNASUi 23142.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000334635 ; ENSP00000334625 ; ENSG00000109184 . [Q92564-1 ]
ENST00000381441 ; ENSP00000370850 ; ENSG00000109184 . [Q92564-2 ]
ENST00000451288 ; ENSP00000389900 ; ENSG00000109184 . [Q92564-3 ]
GeneIDi 23142.
KEGGi hsa:23142.
UCSCi uc003gze.3. human. [Q92564-1 ]
uc003gzf.3. human. [Q92564-2 ]

Organism-specific databases

CTDi 23142.
GeneCardsi GC04P052709.
HGNCi HGNC:28998. DCUN1D4.
HPAi HPA036483.
HPA036484.
MIMi 612977. gene.
neXtProti NX_Q92564.
PharmGKBi PA142672010.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG279481.
GeneTreei ENSGT00550000074529.
HOGENOMi HOG000241761.
HOVERGENi HBG106637.
InParanoidi Q92564.
KOi K17824.
PhylomeDBi Q92564.
TreeFami TF354270.

Miscellaneous databases

ChiTaRSi DCUN1D4. human.
GeneWikii DCUN1D4.
GenomeRNAii 23142.
NextBioi 35471903.
PROi Q92564.
SOURCEi Search...

Gene expression databases

Bgeei Q92564.
CleanExi HS_DCUN1D4.
ExpressionAtlasi Q92564. baseline and differential.
Genevestigatori Q92564.

Family and domain databases

InterProi IPR014764. DCN-prot.
IPR005176. PONY_dom.
[Graphical view ]
PANTHERi PTHR12281. PTHR12281. 1 hit.
Pfami PF03556. Cullin_binding. 1 hit.
[Graphical view ]
PROSITEi PS51229. DCUN1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Retina.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDCNL4_HUMAN
AccessioniPrimary (citable) accession number: Q92564
Secondary accession number(s): B4DH25, Q7Z3F3, Q7Z6B8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: October 29, 2014
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3