Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tripartite motif-containing protein 66

Gene

Trim66

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as transcription repressor; The repressive effects are mediated, at least in part, by recruitment of deacetylase activity. May play a role as negative regulator of postmeiotic genes acting through CBX3 complex formation and centromere association.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri1 – 4646B box-type 1; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri60 – 10142B box-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri996 – 104348PHD-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • chromatin binding Source: MGI
  • protein homodimerization activity Source: MGI
  • zinc ion binding Source: InterPro

GO - Biological processi

  • negative regulation of transcription, DNA-templated Source: MGI
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Tripartite motif-containing protein 66
Alternative name(s):
Transcriptional intermediary factor 1 delta
Gene namesi
Name:Trim66
Synonyms:Tif1d
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2152406. Trim66.

Subcellular locationi

  • Nucleus 1 Publication

  • Note: Forms discrete foci within the centromeric chromocenter and surrounding nucleoplasm.

GO - Cellular componenti

  • aggresome Source: MGI
  • chromocenter Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi889 – 8891V → A: Drastic decrease of CBX5, CBX1 and CBX3 binding; When associated with A-891. 1 Publication
Mutagenesisi891 – 8911L → A: Drastic decrease of CBX5, CBX1 and CBX3 binding; When associated with A-889. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12421242Tripartite motif-containing protein 66PRO_0000220376Add
BLAST

Proteomic databases

MaxQBiQ924W6.
PaxDbiQ924W6.
PRIDEiQ924W6.

PTM databases

iPTMnetiQ924W6.
PhosphoSiteiQ924W6.

Expressioni

Tissue specificityi

Predominant in testis, specifically in elongating spermatids.1 Publication

Developmental stagei

No significant expression in testis of 2- or 3-week-old mouse, but clear detection at the age of 4 weeks.1 Publication

Gene expression databases

BgeeiQ924W6.
CleanExiMM_TRIM66.
ExpressionAtlasiQ924W6. baseline and differential.

Interactioni

Subunit structurei

Can form homodimers and heterodimers. Interacts with CBX5, CBX1 and CBX3 via PxVxL motif.1 Publication

GO - Molecular functioni

  • protein homodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi236997. 4 interactions.
STRINGi10090.ENSMUSP00000102352.

Structurei

3D structure databases

ProteinModelPortaliQ924W6.
SMRiQ924W6. Positions 59-103, 995-1175.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1084 – 115673BromoPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili130 – 20071Sequence analysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi887 – 8915PxVxL motif

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi329 – 493165Pro-richAdd
BLAST

Sequence similaritiesi

Contains 2 B box-type zinc fingers.PROSITE-ProRule annotation
Contains 1 bromo domain.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri1 – 4646B box-type 1; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri60 – 10142B box-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri996 – 104348PHD-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Bromodomain, Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG41106NJ. LUCA.
GeneTreeiENSGT00530000062982.
HOGENOMiHOG000074104.
HOVERGENiHBG057849.
InParanoidiQ924W6.
KOiK12032.

Family and domain databases

Gene3Di1.20.920.10. 2 hits.
3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR003649. Bbox_C.
IPR001487. Bromodomain.
IPR019786. Zinc_finger_PHD-type_CS.
IPR000315. Znf_B-box.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view]
SMARTiSM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00297. BROMO. 1 hit.
SM00249. PHD. 2 hits.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50119. ZF_BBOX. 2 hits.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q924W6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARNCSECKE KRAAHILCTY CNRWLCSSCT EEHRHVPAPG GPLFARAQKG
60 70 80 90 100
SSGVNGGSGD FALYCPLHTQ EVLKLFCETC DVLTCHSCLM VEHKEHRCRH
110 120 130 140 150
VEEVLQNQRM LLESVTSQVA HKKSSLQTSA KQIEDRIFEV KHQHRKVENQ
160 170 180 190 200
IKMAKMVLMN ELNKQANGLI EELEGITNER KRKLEQQLQS IMVLNRQFEH
210 220 230 240 250
VQNFINWAVC SKSSVPFLFS KELIVFQMQR LLETRCNTDP GSPWSIRFTW
260 270 280 290 300
EPNFWTKQLA SLGCITTEGG QLTRADAAAA SYGSLQGQPS FYQSHQAPMA
310 320 330 340 350
QQEALSHPSH KFQSPALCSS SVCCSHCSPV SPSLKGQVPP PSIHPAHSFR
360 370 380 390 400
QPSEMVPHQL GSLQCSTLLP REKELACSPH PPKLMQPWLE PQPPAEQEST
410 420 430 440 450
SQRPGPQLVS QPVCIVPPQD VQPGAHAQPT IQTPSIQVQL GHHQKLKLSH
460 470 480 490 500
FQQQPQQQPP PPPPPPPPPQ HAPPPLPPSQ HLASSQHESP PGPACSQNVD
510 520 530 540 550
IMHHKFELEE MQKDLELLLQ AQQPSLQLSQ TKSPQHLQQT IVGQINYIVR
560 570 580 590 600
QPAPVQSQSQ EETLQVTEEP PAPEGPKPAL PVDKNTAAPL PQTSGEETPH
610 620 630 640 650
SVPPVDGTSQ HSSPNVVRKH ATSVSIMGFS NTVEMELSST RLARTIEPQI
660 670 680 690 700
HRVSSLTAAP THTIPSLLSG PPQTVSSLMS VSNHAMPSLT ASHLQPVPNL
710 720 730 740 750
VRGTFQSTSN LRGDSSQAIT GLASNHSQAG PSLMSGHTQA APSLATCPLQ
760 770 780 790 800
GMPPVSDVHV EPRSVSSPGS GPAAESLGTR DGAESSLGNA LCKMESEDCT
810 820 830 840 850
RFSDSVGQGP TASSLDGPKD LAIPSELEEP INLSVKKPFL APVINTSTAL
860 870 880 890 900
QQYRNPKEYE NFEQGALELD TKENSDIRAI SSEPKIPYVR LERLKICAAS
910 920 930 940 950
SGEMPVFKLK PQKNSQDGNF LLVIECGTES SSMSIKVSQN SLPDASQGPG
960 970 980 990 1000
LGGRKVTVTS LTGQQPQEVE STSEEHRLIP RAPGAKKNTP APIENEDFCA
1010 1020 1030 1040 1050
VCINGGELLC CDRCPKVYHL SCHVPALLSF PGGEWVCTLC RSLTQPEMEY
1060 1070 1080 1090 1100
DCENARYGHP GVRVLPGLSM YDQKKCEKLV LSLCCNSLSL PFHEPVSPLA
1110 1120 1130 1140 1150
RHYYQIIKRP MDLSIIRRKL QKKDPAHYTT PEEVVSDVRL MFWNCAKFNY
1160 1170 1180 1190 1200
PDSEVAEAGR CLEVFFEGWL KEIYPDKCFA QPQQEDSDSE DVSGESGCST
1210 1220 1230 1240
PQGFPWPPYM QEGIQPKRRR RHMENEKTKR VSFRLANSIS QV
Length:1,242
Mass (Da):136,766
Last modified:July 27, 2011 - v3
Checksum:i98606ACB8BA70243
GO
Isoform 2 (identifier: Q924W6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-98: Missing.
     794-825: MESEDCTRFSDSVGQGPTASSLDGPKDLAIPS → V

Show »
Length:1,209
Mass (Da):133,325
Checksum:iA09AE83390F46D6C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti43 – 431L → I in AAS78677 (PubMed:15322135).Curated
Sequence conflicti818 – 8181P → S in AAS78677 (PubMed:15322135).Curated
Sequence conflicti879 – 8791A → T in AAS78677 (PubMed:15322135).Curated
Sequence conflicti919 – 9191N → S in AAS78677 (PubMed:15322135).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei97 – 982Missing in isoform 2. CuratedVSP_026555
Alternative sequencei794 – 82532MESED…LAIPS → V in isoform 2. CuratedVSP_026556Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ307670 Genomic DNA. Translation: CAC38114.1.
AY572455 mRNA. Translation: AAS78677.1.
AC124457 Genomic DNA. No translation available.
CCDSiCCDS40082.1. [Q924W6-1]
RefSeqiNP_862901.3. NM_181853.4. [Q924W6-1]
XP_006508022.1. XM_006507959.1. [Q924W6-1]
XP_006508023.1. XM_006507960.2. [Q924W6-1]
XP_006508024.1. XM_006507961.2. [Q924W6-1]
XP_006508025.1. XM_006507962.1. [Q924W6-1]
XP_011240137.1. XM_011241835.1. [Q924W6-1]
UniGeneiMm.183528.

Genome annotation databases

EnsembliENSMUST00000033339; ENSMUSP00000033339; ENSMUSG00000031026. [Q924W6-1]
GeneIDi330627.
KEGGimmu:330627.
UCSCiuc012fsa.1. mouse. [Q924W6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ307670 Genomic DNA. Translation: CAC38114.1.
AY572455 mRNA. Translation: AAS78677.1.
AC124457 Genomic DNA. No translation available.
CCDSiCCDS40082.1. [Q924W6-1]
RefSeqiNP_862901.3. NM_181853.4. [Q924W6-1]
XP_006508022.1. XM_006507959.1. [Q924W6-1]
XP_006508023.1. XM_006507960.2. [Q924W6-1]
XP_006508024.1. XM_006507961.2. [Q924W6-1]
XP_006508025.1. XM_006507962.1. [Q924W6-1]
XP_011240137.1. XM_011241835.1. [Q924W6-1]
UniGeneiMm.183528.

3D structure databases

ProteinModelPortaliQ924W6.
SMRiQ924W6. Positions 59-103, 995-1175.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236997. 4 interactions.
STRINGi10090.ENSMUSP00000102352.

PTM databases

iPTMnetiQ924W6.
PhosphoSiteiQ924W6.

Proteomic databases

MaxQBiQ924W6.
PaxDbiQ924W6.
PRIDEiQ924W6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033339; ENSMUSP00000033339; ENSMUSG00000031026. [Q924W6-1]
GeneIDi330627.
KEGGimmu:330627.
UCSCiuc012fsa.1. mouse. [Q924W6-1]

Organism-specific databases

CTDi9866.
MGIiMGI:2152406. Trim66.

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG41106NJ. LUCA.
GeneTreeiENSGT00530000062982.
HOGENOMiHOG000074104.
HOVERGENiHBG057849.
InParanoidiQ924W6.
KOiK12032.

Miscellaneous databases

NextBioi352291.
PROiQ924W6.
SOURCEiSearch...

Gene expression databases

BgeeiQ924W6.
CleanExiMM_TRIM66.
ExpressionAtlasiQ924W6. baseline and differential.

Family and domain databases

Gene3Di1.20.920.10. 2 hits.
3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR003649. Bbox_C.
IPR001487. Bromodomain.
IPR019786. Zinc_finger_PHD-type_CS.
IPR000315. Znf_B-box.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view]
SMARTiSM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00297. BROMO. 1 hit.
SM00249. PHD. 2 hits.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50119. ZF_BBOX. 2 hits.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7."
    Amid C., Bahr A., Mujica A., Sampson N., Bikar S.E., Winterpacht A., Zabel B., Hankeln T., Schmidt E.R.
    Cytogenet. Cell Genet. 93:284-290(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 2).
  2. "TIF1delta, a novel HP1-interacting member of the transcriptional intermediary factor 1 (TIF1) family expressed by elongating spermatids."
    Khetchoumian K., Teletin M., Mark M., Lerouge T., Cervino M., Oulad-Abdelghani M., Chambon P., Losson R.
    J. Biol. Chem. 279:48329-48341(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, MOTIF, INTERACTION WITH CBX5, CBX1 AND CBX3, MUTAGENESIS OF VAL-889 AND LEU-891, SUBCELLULAR LOCATION.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.

Entry informationi

Entry nameiTRI66_MOUSE
AccessioniPrimary (citable) accession number: Q924W6
Secondary accession number(s): E9QKN7, Q5SEK4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: July 27, 2011
Last modified: May 11, 2016
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.