Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sprouty-related, EVH1 domain-containing protein 1

Gene

Spred1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.2 Publications

GO - Molecular functioni

  • phosphatase binding Source: UniProtKB
  • protein kinase binding Source: BHF-UCL
  • protein serine/threonine kinase inhibitor activity Source: BHF-UCL
  • stem cell factor receptor binding Source: MGI

GO - Biological processi

  • inactivation of MAPK activity Source: MGI
  • negative regulation of angiogenesis Source: BHF-UCL
  • negative regulation of cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • negative regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  • negative regulation of MAPK cascade Source: MGI
  • negative regulation of peptidyl-threonine phosphorylation Source: BHF-UCL
  • negative regulation of phosphatase activity Source: UniProtKB
  • negative regulation of protein kinase activity Source: MGI
  • positive regulation of DNA damage response, signal transduction by p53 class mediator Source: BHF-UCL
  • regulation of protein deacetylation Source: BHF-UCL
  • vasculogenesis involved in coronary vascular morphogenesis Source: MGI

Enzyme and pathway databases

ReactomeiR-MMU-5658442 Regulation of RAS by GAPs
R-MMU-5658623 FGFRL1 modulation of FGFR1 signaling

Names & Taxonomyi

Protein namesi
Recommended name:
Sprouty-related, EVH1 domain-containing protein 1
Short name:
Spred-1
Gene namesi
Name:Spred1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2150016 Spred1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000769082 – 444Sprouty-related, EVH1 domain-containing protein 1Add BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei225N6-methyllysineBy similarity1
Modified residuei239PhosphoserineCombined sources1
Modified residuei309PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ924S8
PaxDbiQ924S8
PeptideAtlasiQ924S8
PRIDEiQ924S8

PTM databases

iPTMnetiQ924S8
PhosphoSitePlusiQ924S8
SwissPalmiQ924S8

Expressioni

Tissue specificityi

Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (Ba/F3 and MC/9) and bone marrow-derived mast cells (BMMC).4 Publications

Gene expression databases

BgeeiENSMUSG00000027351
GenevisibleiQ924S8 MM

Interactioni

Subunit structurei

Interacts with TAOK2 and TESK1 (By similarity). Homodimer and heterodimer. Interacts with CAV1. Able to interact with SPRED2 to form heterodimers (By similarity). Interacts with ras.By similarity1 Publication

GO - Molecular functioni

  • phosphatase binding Source: UniProtKB
  • protein kinase binding Source: BHF-UCL
  • stem cell factor receptor binding Source: MGI

Protein-protein interaction databases

IntActiQ924S8, 1 interactor
STRINGi10090.ENSMUSP00000028829

Structurei

3D structure databases

ProteinModelPortaliQ924S8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 123WH1PROSITE-ProRule annotationAdd BLAST118
Domaini234 – 286KBDPROSITE-ProRule annotationAdd BLAST53
Domaini334 – 442SPRPROSITE-ProRule annotationAdd BLAST109

Phylogenomic databases

eggNOGiENOG410IQ20 Eukaryota
ENOG4112CZ7 LUCA
GeneTreeiENSGT00730000110272
HOGENOMiHOG000220886
HOVERGENiHBG057556
InParanoidiQ924S8
KOiK04703
OMAiISQGCPA
OrthoDBiEOG091G0OE8
PhylomeDBiQ924S8
TreeFamiTF321411

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR023337 KBD
IPR011993 PH-like_dom_sf
IPR007875 Sprouty
IPR000697 WH1/EVH1_dom
PfamiView protein in Pfam
PF05210 Sprouty, 1 hit
PF00568 WH1, 1 hit
SMARTiView protein in SMART
SM00461 WH1, 1 hit
PROSITEiView protein in PROSITE
PS51488 KBD, 1 hit
PS51227 SPR, 1 hit
PS50229 WH1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q924S8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEETATSDN DNSYARVRAV VMTRDDSSGG WLPLGGSGLS SVTVFRVPHQ
60 70 80 90 100
EENGCADFFI RGERLRDKMV VLECMLKKDL IYNKVTPTFH HWKIDDKKFG
110 120 130 140 150
LTFQSPADAR AFDRGIRRAI EDISLGCPAS KTEAEGGDDD LQTTEEDTSR
160 170 180 190 200
SLVKDHFFQQ ETVVTSEPYR SSDIRPLPFE DLNARRVYLQ SQVSQIPFSQ
210 220 230 240 250
QGLDIQSRSM EYVQRQISKE CGSLKSQTRV PLKSIRHVSF QDEDEIVRIN
260 270 280 290 300
PRDILIRRYA DYRHPDMWKN DLERDDTDSS VPFSKQDSKK SDYLYHCGDE
310 320 330 340 350
TKLSSLKDSV VFKTQPPSLK FKSKRRKEDG ERSRCVYCQE RFNHEENARG
360 370 380 390 400
KCQDAPDPVK RCIYQVSCML CAESMLYHCM SDSEGDFSDP CSCDTSDDKF
410 420 430 440
CLRWLALVAL SFIVPCMCCY VPLRMCHRCG EACGCCGGKH KAAG
Length:444
Mass (Da):50,664
Last modified:December 1, 2001 - v1
Checksum:iB716DCB4AEA9F171
GO
Isoform 2 (identifier: Q924S8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-229: IPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTR → VRRRILFPCIAYIEKLGVLQNTKALRSFPCYETI
     230-444: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):26,024
Checksum:iE4FDEBDE64B0F9D0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti144T → I in AAH57874 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012412196 – 229IPFSQ…KSQTR → VRRRILFPCIAYIEKLGVLQ NTKALRSFPCYETI in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_012413230 – 444Missing in isoform 2. 1 PublicationAdd BLAST215

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB063495 mRNA Translation: BAB62848.1
AK155065 mRNA Translation: BAE33024.1
AL807741, AL928959 Genomic DNA Translation: CAM17918.1
AL928959, AL807741 Genomic DNA Translation: CAM26783.1
BC057874 mRNA Translation: AAH57874.1
BC079606 mRNA Translation: AAH79606.1
CCDSiCCDS16570.1 [Q924S8-1]
CCDS71115.1 [Q924S8-2]
RefSeqiNP_001264185.1, NM_001277256.1 [Q924S8-2]
NP_277059.1, NM_033524.3 [Q924S8-1]
UniGeneiMm.245890
Mm.392720
Mm.392726
Mm.397626

Genome annotation databases

EnsembliENSMUST00000028829; ENSMUSP00000028829; ENSMUSG00000027351 [Q924S8-1]
ENSMUST00000110901; ENSMUSP00000106526; ENSMUSG00000027351 [Q924S8-2]
GeneIDi114715
KEGGimmu:114715
UCSCiuc008lrh.2 mouse [Q924S8-2]
uc008lri.2 mouse [Q924S8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPRE1_MOUSE
AccessioniPrimary (citable) accession number: Q924S8
Secondary accession number(s): Q3U2W6, Q6PET8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: December 1, 2001
Last modified: March 28, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health