Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q924S8

- SPRE1_MOUSE

UniProt

Q924S8 - SPRE1_MOUSE

Protein

Sprouty-related, EVH1 domain-containing protein 1

Gene

Spred1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.2 Publications

    GO - Molecular functioni

    1. phosphatase binding Source: UniProtKB
    2. protein binding Source: MGI
    3. protein kinase binding Source: BHF-UCL
    4. protein serine/threonine kinase inhibitor activity Source: BHF-UCL
    5. stem cell factor receptor binding Source: MGI

    GO - Biological processi

    1. inactivation of MAPK activity Source: MGI
    2. multicellular organismal development Source: InterPro
    3. negative regulation of peptidyl-threonine phosphorylation Source: BHF-UCL
    4. negative regulation of phosphatase activity Source: UniProtKB
    5. positive regulation of DNA damage response, signal transduction by p53 class mediator Source: BHF-UCL
    6. regulation of protein deacetylation Source: BHF-UCL

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sprouty-related, EVH1 domain-containing protein 1
    Short name:
    Spred-1
    Gene namesi
    Name:Spred1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:2150016. Spred1.

    Subcellular locationi

    Cell membrane 1 Publication; Peripheral membrane protein 1 Publication. Membranecaveola 1 Publication; Peripheral membrane protein 1 Publication. Nucleus 1 Publication
    Note: Localized in cholesterol-rich membrane raft/caveola fractions.By similarity

    GO - Cellular componenti

    1. caveola Source: UniProtKB-SubCell
    2. cytoplasm Source: Ensembl
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 444443Sprouty-related, EVH1 domain-containing protein 1PRO_0000076908Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserineBy similarity
    Modified residuei239 – 2391Phosphoserine2 Publications

    Post-translational modificationi

    Phosphorylated on tyrosine.2 Publications

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ924S8.
    PRIDEiQ924S8.

    PTM databases

    PhosphoSiteiQ924S8.

    Expressioni

    Tissue specificityi

    Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (Ba/F3 and MC/9) and bone marrow-derived mast cells (BMMC).4 Publications

    Gene expression databases

    BgeeiQ924S8.
    GenevestigatoriQ924S8.

    Interactioni

    Subunit structurei

    Interacts with TAOK2 and TESK1 By similarity. Homodimer and heterodimer. Interacts with CAV1. Able to interact with SPRED2 to form heterodimers By similarity. Interacts with ras.By similarity1 Publication

    Protein-protein interaction databases

    IntActiQ924S8. 1 interaction.
    MINTiMINT-4997937.

    Structurei

    3D structure databases

    ProteinModelPortaliQ924S8.
    SMRiQ924S8. Positions 13-127.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini6 – 123118WH1PROSITE-ProRule annotationAdd
    BLAST
    Domaini234 – 28653KBDPROSITE-ProRule annotationAdd
    BLAST
    Domaini334 – 442109SPRPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 KBD domain.PROSITE-ProRule annotation
    Contains 1 SPR (sprouty) domain.PROSITE-ProRule annotation
    Contains 1 WH1 domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG277322.
    GeneTreeiENSGT00730000110272.
    HOGENOMiHOG000220886.
    HOVERGENiHBG057556.
    InParanoidiQ924S8.
    KOiK04703.
    OMAiCVTVFKV.
    OrthoDBiEOG7T7GV7.
    PhylomeDBiQ924S8.
    TreeFamiTF321411.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR023337. KBD.
    IPR011993. PH_like_dom.
    IPR007875. Sprouty.
    IPR000697. WH1/EVH1.
    [Graphical view]
    PfamiPF05210. Sprouty. 1 hit.
    PF00568. WH1. 1 hit.
    [Graphical view]
    PROSITEiPS51488. KBD. 1 hit.
    PS51227. SPR. 1 hit.
    PS50229. WH1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q924S8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSEETATSDN DNSYARVRAV VMTRDDSSGG WLPLGGSGLS SVTVFRVPHQ    50
    EENGCADFFI RGERLRDKMV VLECMLKKDL IYNKVTPTFH HWKIDDKKFG 100
    LTFQSPADAR AFDRGIRRAI EDISLGCPAS KTEAEGGDDD LQTTEEDTSR 150
    SLVKDHFFQQ ETVVTSEPYR SSDIRPLPFE DLNARRVYLQ SQVSQIPFSQ 200
    QGLDIQSRSM EYVQRQISKE CGSLKSQTRV PLKSIRHVSF QDEDEIVRIN 250
    PRDILIRRYA DYRHPDMWKN DLERDDTDSS VPFSKQDSKK SDYLYHCGDE 300
    TKLSSLKDSV VFKTQPPSLK FKSKRRKEDG ERSRCVYCQE RFNHEENARG 350
    KCQDAPDPVK RCIYQVSCML CAESMLYHCM SDSEGDFSDP CSCDTSDDKF 400
    CLRWLALVAL SFIVPCMCCY VPLRMCHRCG EACGCCGGKH KAAG 444
    Length:444
    Mass (Da):50,664
    Last modified:December 1, 2001 - v1
    Checksum:iB716DCB4AEA9F171
    GO
    Isoform 2 (identifier: Q924S8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         196-229: IPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTR → VRRRILFPCIAYIEKLGVLQNTKALRSFPCYETI
         230-444: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:229
    Mass (Da):26,024
    Checksum:iE4FDEBDE64B0F9D0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti144 – 1441T → I in AAH57874. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei196 – 22934IPFSQ…KSQTR → VRRRILFPCIAYIEKLGVLQ NTKALRSFPCYETI in isoform 2. 1 PublicationVSP_012412Add
    BLAST
    Alternative sequencei230 – 444215Missing in isoform 2. 1 PublicationVSP_012413Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB063495 mRNA. Translation: BAB62848.1.
    AK155065 mRNA. Translation: BAE33024.1.
    AL807741, AL928959 Genomic DNA. Translation: CAM17918.1.
    AL928959, AL807741 Genomic DNA. Translation: CAM26783.1.
    BC057874 mRNA. Translation: AAH57874.1.
    BC079606 mRNA. Translation: AAH79606.1.
    CCDSiCCDS16570.1. [Q924S8-1]
    CCDS71115.1. [Q924S8-2]
    RefSeqiNP_001264185.1. NM_001277256.1. [Q924S8-2]
    NP_277059.1. NM_033524.3. [Q924S8-1]
    UniGeneiMm.245890.
    Mm.392720.
    Mm.392726.
    Mm.397626.

    Genome annotation databases

    EnsembliENSMUST00000028829; ENSMUSP00000028829; ENSMUSG00000027351. [Q924S8-1]
    ENSMUST00000110901; ENSMUSP00000106526; ENSMUSG00000027351. [Q924S8-2]
    GeneIDi114715.
    KEGGimmu:114715.
    UCSCiuc008lri.1. mouse. [Q924S8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB063495 mRNA. Translation: BAB62848.1 .
    AK155065 mRNA. Translation: BAE33024.1 .
    AL807741 , AL928959 Genomic DNA. Translation: CAM17918.1 .
    AL928959 , AL807741 Genomic DNA. Translation: CAM26783.1 .
    BC057874 mRNA. Translation: AAH57874.1 .
    BC079606 mRNA. Translation: AAH79606.1 .
    CCDSi CCDS16570.1. [Q924S8-1 ]
    CCDS71115.1. [Q924S8-2 ]
    RefSeqi NP_001264185.1. NM_001277256.1. [Q924S8-2 ]
    NP_277059.1. NM_033524.3. [Q924S8-1 ]
    UniGenei Mm.245890.
    Mm.392720.
    Mm.392726.
    Mm.397626.

    3D structure databases

    ProteinModelPortali Q924S8.
    SMRi Q924S8. Positions 13-127.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q924S8. 1 interaction.
    MINTi MINT-4997937.

    PTM databases

    PhosphoSitei Q924S8.

    Proteomic databases

    PaxDbi Q924S8.
    PRIDEi Q924S8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000028829 ; ENSMUSP00000028829 ; ENSMUSG00000027351 . [Q924S8-1 ]
    ENSMUST00000110901 ; ENSMUSP00000106526 ; ENSMUSG00000027351 . [Q924S8-2 ]
    GeneIDi 114715.
    KEGGi mmu:114715.
    UCSCi uc008lri.1. mouse. [Q924S8-1 ]

    Organism-specific databases

    CTDi 161742.
    MGIi MGI:2150016. Spred1.

    Phylogenomic databases

    eggNOGi NOG277322.
    GeneTreei ENSGT00730000110272.
    HOGENOMi HOG000220886.
    HOVERGENi HBG057556.
    InParanoidi Q924S8.
    KOi K04703.
    OMAi CVTVFKV.
    OrthoDBi EOG7T7GV7.
    PhylomeDBi Q924S8.
    TreeFami TF321411.

    Miscellaneous databases

    NextBioi 368737.
    PROi Q924S8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q924S8.
    Genevestigatori Q924S8.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR023337. KBD.
    IPR011993. PH_like_dom.
    IPR007875. Sprouty.
    IPR000697. WH1/EVH1.
    [Graphical view ]
    Pfami PF05210. Sprouty. 1 hit.
    PF00568. WH1. 1 hit.
    [Graphical view ]
    PROSITEi PS51488. KBD. 1 hit.
    PS51227. SPR. 1 hit.
    PS50229. WH1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH RAS, PHOSPHORYLATION, TISSUE SPECIFICITY, FUNCTION.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: NOD.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6.
      Tissue: Brain and Mammary gland.
    5. "Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation."
      Kato R., Nonami A., Taketomi T., Wakioka T., Kuroiwa A., Matsuda Y., Yoshimura A.
      Biochem. Biophys. Res. Commun. 302:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    6. "Expression and subcellular localization of Spred proteins in mouse and human tissues."
      Engelhardt C.M., Bundschu K., Messerschmitt M., Renne T., Walter U., Reinhard M., Schuh K.
      Histochem. Cell Biol. 122:527-538(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. "Spred-1 negatively regulates interleukin-3-mediated ERK/mitogen-activated protein (MAP) kinase activation in hematopoietic cells."
      Nonami A., Kato R., Taniguchi K., Yoshiga D., Taketomi T., Fukuyama S., Harada M., Sasaki A., Yoshimura A.
      J. Biol. Chem. 279:52543-52551(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    8. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSPRE1_MOUSE
    AccessioniPrimary (citable) accession number: Q924S8
    Secondary accession number(s): Q3U2W6, Q6PET8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 4, 2005
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3