Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q924S8 (SPRE1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sprouty-related, EVH1 domain-containing protein 1

Short name=Spred-1
Gene names
Name:Spred1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length444 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow. Ref.1 Ref.7

Subunit structure

Interacts with TAOK2 and TESK1 By similarity. Homodimer and heterodimer. Interacts with CAV1. Able to interact with SPRED2 to form heterodimers By similarity. Interacts with ras. Ref.1

Subcellular location

Cell membrane; Peripheral membrane protein. Membranecaveola; Peripheral membrane protein. Nucleus. Note: Localized in cholesterol-rich membrane raft/caveola fractions By similarity. Ref.1

Tissue specificity

Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (Ba/F3 and MC/9) and bone marrow-derived mast cells (BMMC). Ref.1 Ref.5 Ref.6 Ref.7

Post-translational modification

Phosphorylated on tyrosine. Ref.1

Sequence similarities

Contains 1 KBD domain.

Contains 1 SPR (sprouty) domain.

Contains 1 WH1 domain.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
Nucleus
   Coding sequence diversityAlternative splicing
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processinactivation of MAPK activity

Inferred from mutant phenotype Ref.5. Source: MGI

multicellular organismal development

Inferred from electronic annotation. Source: InterPro

negative regulation of peptidyl-threonine phosphorylation

Inferred from direct assay PubMed 20736167. Source: BHF-UCL

negative regulation of phosphatase activity

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of DNA damage response, signal transduction by p53 class mediator

Inferred from direct assay PubMed 20736167. Source: BHF-UCL

regulation of protein deacetylation

Inferred from direct assay PubMed 20736167. Source: BHF-UCL

   Cellular_componentcaveola

Inferred from electronic annotation. Source: UniProtKB-SubCell

cytoplasm

Inferred from electronic annotation. Source: Ensembl

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionphosphatase binding

Inferred from sequence or structural similarity. Source: UniProtKB

protein kinase binding

Inferred from physical interaction PubMed 20736167. Source: BHF-UCL

protein serine/threonine kinase inhibitor activity

Inferred from direct assay PubMed 20736167. Source: BHF-UCL

stem cell factor receptor binding

Inferred from physical interaction Ref.5. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q924S8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q924S8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     196-229: IPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTR → VRRRILFPCIAYIEKLGVLQNTKALRSFPCYETI
     230-444: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 444443Sprouty-related, EVH1 domain-containing protein 1
PRO_0000076908

Regions

Domain6 – 123118WH1
Domain234 – 28653KBD
Domain334 – 442109SPR

Amino acid modifications

Modified residue21N-acetylserine By similarity
Modified residue2391Phosphoserine Ref.8

Natural variations

Alternative sequence196 – 22934IPFSQ…KSQTR → VRRRILFPCIAYIEKLGVLQ NTKALRSFPCYETI in isoform 2.
VSP_012412
Alternative sequence230 – 444215Missing in isoform 2.
VSP_012413

Experimental info

Sequence conflict1441T → I in AAH57874. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: B716DCB4AEA9F171

FASTA44450,664
        10         20         30         40         50         60 
MSEETATSDN DNSYARVRAV VMTRDDSSGG WLPLGGSGLS SVTVFRVPHQ EENGCADFFI 

        70         80         90        100        110        120 
RGERLRDKMV VLECMLKKDL IYNKVTPTFH HWKIDDKKFG LTFQSPADAR AFDRGIRRAI 

       130        140        150        160        170        180 
EDISLGCPAS KTEAEGGDDD LQTTEEDTSR SLVKDHFFQQ ETVVTSEPYR SSDIRPLPFE 

       190        200        210        220        230        240 
DLNARRVYLQ SQVSQIPFSQ QGLDIQSRSM EYVQRQISKE CGSLKSQTRV PLKSIRHVSF 

       250        260        270        280        290        300 
QDEDEIVRIN PRDILIRRYA DYRHPDMWKN DLERDDTDSS VPFSKQDSKK SDYLYHCGDE 

       310        320        330        340        350        360 
TKLSSLKDSV VFKTQPPSLK FKSKRRKEDG ERSRCVYCQE RFNHEENARG KCQDAPDPVK 

       370        380        390        400        410        420 
RCIYQVSCML CAESMLYHCM SDSEGDFSDP CSCDTSDDKF CLRWLALVAL SFIVPCMCCY 

       430        440 
VPLRMCHRCG EACGCCGGKH KAAG 

« Hide

Isoform 2 [UniParc].

Checksum: E4FDEBDE64B0F9D0
Show »

FASTA22926,024

References

« Hide 'large scale' references
[1]"Spred is a Sprouty-related suppressor of Ras signalling."
Wakioka T., Sasaki A., Kato R., Shouda T., Matsumoto A., Miyoshi K., Tsuneoka M., Komiya S., Baron R., Yoshimura A.
Nature 412:647-651(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH RAS, PHOSPHORYLATION, TISSUE SPECIFICITY, FUNCTION.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: NOD.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6.
Tissue: Brain and Mammary gland.
[5]"Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation."
Kato R., Nonami A., Taketomi T., Wakioka T., Kuroiwa A., Matsuda Y., Yoshimura A.
Biochem. Biophys. Res. Commun. 302:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[6]"Expression and subcellular localization of Spred proteins in mouse and human tissues."
Engelhardt C.M., Bundschu K., Messerschmitt M., Renne T., Walter U., Reinhard M., Schuh K.
Histochem. Cell Biol. 122:527-538(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[7]"Spred-1 negatively regulates interleukin-3-mediated ERK/mitogen-activated protein (MAP) kinase activation in hematopoietic cells."
Nonami A., Kato R., Taniguchi K., Yoshiga D., Taketomi T., Fukuyama S., Harada M., Sasaki A., Yoshimura A.
J. Biol. Chem. 279:52543-52551(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[8]"The phagosomal proteome in interferon-gamma-activated macrophages."
Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB063495 mRNA. Translation: BAB62848.1.
AK155065 mRNA. Translation: BAE33024.1.
AL807741, AL928959 Genomic DNA. Translation: CAM17918.1.
AL928959, AL807741 Genomic DNA. Translation: CAM26783.1.
BC057874 mRNA. Translation: AAH57874.1.
BC079606 mRNA. Translation: AAH79606.1.
RefSeqNP_001264185.1. NM_001277256.1.
NP_277059.1. NM_033524.3.
UniGeneMm.245890.
Mm.392720.
Mm.392726.
Mm.397626.

3D structure databases

ProteinModelPortalQ924S8.
SMRQ924S8. Positions 13-127.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-4997937.

PTM databases

PhosphoSiteQ924S8.

Proteomic databases

PaxDbQ924S8.
PRIDEQ924S8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000028829; ENSMUSP00000028829; ENSMUSG00000027351. [Q924S8-1]
ENSMUST00000110901; ENSMUSP00000106526; ENSMUSG00000027351. [Q924S8-2]
GeneID114715.
KEGGmmu:114715.
UCSCuc008lri.1. mouse. [Q924S8-1]

Organism-specific databases

CTD161742.
MGIMGI:2150016. Spred1.

Phylogenomic databases

eggNOGNOG277322.
GeneTreeENSGT00730000110272.
HOGENOMHOG000220886.
HOVERGENHBG057556.
InParanoidQ924S8.
KOK04703.
OMACVTVFKV.
OrthoDBEOG7T7GV7.
PhylomeDBQ924S8.
TreeFamTF321411.

Gene expression databases

BgeeQ924S8.
GenevestigatorQ924S8.

Family and domain databases

Gene3D2.30.29.30. 1 hit.
InterProIPR023337. KBD.
IPR011993. PH_like_dom.
IPR007875. Sprouty.
IPR000697. WH1/EVH1.
[Graphical view]
PfamPF05210. Sprouty. 1 hit.
PF00568. WH1. 1 hit.
[Graphical view]
PROSITEPS51488. KBD. 1 hit.
PS51227. SPR. 1 hit.
PS50229. WH1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio368737.
PROQ924S8.
SOURCESearch...

Entry information

Entry nameSPRE1_MOUSE
AccessionPrimary (citable) accession number: Q924S8
Secondary accession number(s): Q3U2W6, Q6PET8
Entry history
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot