Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q924S8

- SPRE1_MOUSE

UniProt

Q924S8 - SPRE1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sprouty-related, EVH1 domain-containing protein 1

Gene

Spred1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.2 Publications

GO - Molecular functioni

  1. phosphatase binding Source: UniProtKB
  2. protein kinase binding Source: BHF-UCL
  3. protein serine/threonine kinase inhibitor activity Source: BHF-UCL
  4. stem cell factor receptor binding Source: MGI

GO - Biological processi

  1. inactivation of MAPK activity Source: MGI
  2. multicellular organismal development Source: InterPro
  3. negative regulation of peptidyl-threonine phosphorylation Source: BHF-UCL
  4. negative regulation of phosphatase activity Source: UniProtKB
  5. positive regulation of DNA damage response, signal transduction by p53 class mediator Source: BHF-UCL
  6. regulation of protein deacetylation Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sprouty-related, EVH1 domain-containing protein 1
Short name:
Spred-1
Gene namesi
Name:Spred1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:2150016. Spred1.

Subcellular locationi

Cell membrane 1 Publication; Peripheral membrane protein 1 Publication. Membranecaveola 1 Publication; Peripheral membrane protein 1 Publication. Nucleus 1 Publication
Note: Localized in cholesterol-rich membrane raft/caveola fractions.By similarity

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. nucleus Source: UniProtKB-KW
  3. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 444443Sprouty-related, EVH1 domain-containing protein 1PRO_0000076908Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei239 – 2391Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated on tyrosine.2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ924S8.
PaxDbiQ924S8.
PRIDEiQ924S8.

PTM databases

PhosphoSiteiQ924S8.

Expressioni

Tissue specificityi

Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (Ba/F3 and MC/9) and bone marrow-derived mast cells (BMMC).4 Publications

Gene expression databases

BgeeiQ924S8.
GenevestigatoriQ924S8.

Interactioni

Subunit structurei

Interacts with TAOK2 and TESK1 (By similarity). Homodimer and heterodimer. Interacts with CAV1. Able to interact with SPRED2 to form heterodimers (By similarity). Interacts with ras.By similarity1 Publication

Protein-protein interaction databases

IntActiQ924S8. 1 interaction.
MINTiMINT-4997937.

Structurei

3D structure databases

ProteinModelPortaliQ924S8.
SMRiQ924S8. Positions 13-127.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 123118WH1PROSITE-ProRule annotationAdd
BLAST
Domaini234 – 28653KBDPROSITE-ProRule annotationAdd
BLAST
Domaini334 – 442109SPRPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 KBD domain.PROSITE-ProRule annotation
Contains 1 SPR (sprouty) domain.PROSITE-ProRule annotation
Contains 1 WH1 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG277322.
GeneTreeiENSGT00730000110272.
HOGENOMiHOG000220886.
HOVERGENiHBG057556.
InParanoidiQ924S8.
KOiK04703.
OMAiCVTVFKV.
OrthoDBiEOG7T7GV7.
PhylomeDBiQ924S8.
TreeFamiTF321411.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR023337. KBD.
IPR011993. PH_like_dom.
IPR007875. Sprouty.
IPR000697. WH1/EVH1.
[Graphical view]
PfamiPF05210. Sprouty. 1 hit.
PF00568. WH1. 1 hit.
[Graphical view]
PROSITEiPS51488. KBD. 1 hit.
PS51227. SPR. 1 hit.
PS50229. WH1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q924S8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEETATSDN DNSYARVRAV VMTRDDSSGG WLPLGGSGLS SVTVFRVPHQ
60 70 80 90 100
EENGCADFFI RGERLRDKMV VLECMLKKDL IYNKVTPTFH HWKIDDKKFG
110 120 130 140 150
LTFQSPADAR AFDRGIRRAI EDISLGCPAS KTEAEGGDDD LQTTEEDTSR
160 170 180 190 200
SLVKDHFFQQ ETVVTSEPYR SSDIRPLPFE DLNARRVYLQ SQVSQIPFSQ
210 220 230 240 250
QGLDIQSRSM EYVQRQISKE CGSLKSQTRV PLKSIRHVSF QDEDEIVRIN
260 270 280 290 300
PRDILIRRYA DYRHPDMWKN DLERDDTDSS VPFSKQDSKK SDYLYHCGDE
310 320 330 340 350
TKLSSLKDSV VFKTQPPSLK FKSKRRKEDG ERSRCVYCQE RFNHEENARG
360 370 380 390 400
KCQDAPDPVK RCIYQVSCML CAESMLYHCM SDSEGDFSDP CSCDTSDDKF
410 420 430 440
CLRWLALVAL SFIVPCMCCY VPLRMCHRCG EACGCCGGKH KAAG
Length:444
Mass (Da):50,664
Last modified:December 1, 2001 - v1
Checksum:iB716DCB4AEA9F171
GO
Isoform 2 (identifier: Q924S8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-229: IPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTR → VRRRILFPCIAYIEKLGVLQNTKALRSFPCYETI
     230-444: Missing.

Note: No experimental confirmation available.

Show »
Length:229
Mass (Da):26,024
Checksum:iE4FDEBDE64B0F9D0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti144 – 1441T → I in AAH57874. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei196 – 22934IPFSQ…KSQTR → VRRRILFPCIAYIEKLGVLQ NTKALRSFPCYETI in isoform 2. 1 PublicationVSP_012412Add
BLAST
Alternative sequencei230 – 444215Missing in isoform 2. 1 PublicationVSP_012413Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB063495 mRNA. Translation: BAB62848.1.
AK155065 mRNA. Translation: BAE33024.1.
AL807741, AL928959 Genomic DNA. Translation: CAM17918.1.
AL928959, AL807741 Genomic DNA. Translation: CAM26783.1.
BC057874 mRNA. Translation: AAH57874.1.
BC079606 mRNA. Translation: AAH79606.1.
CCDSiCCDS16570.1. [Q924S8-1]
CCDS71115.1. [Q924S8-2]
RefSeqiNP_001264185.1. NM_001277256.1. [Q924S8-2]
NP_277059.1. NM_033524.3. [Q924S8-1]
UniGeneiMm.245890.
Mm.392720.
Mm.392726.
Mm.397626.

Genome annotation databases

EnsembliENSMUST00000028829; ENSMUSP00000028829; ENSMUSG00000027351. [Q924S8-1]
ENSMUST00000110901; ENSMUSP00000106526; ENSMUSG00000027351. [Q924S8-2]
GeneIDi114715.
KEGGimmu:114715.
UCSCiuc008lri.1. mouse. [Q924S8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB063495 mRNA. Translation: BAB62848.1 .
AK155065 mRNA. Translation: BAE33024.1 .
AL807741 , AL928959 Genomic DNA. Translation: CAM17918.1 .
AL928959 , AL807741 Genomic DNA. Translation: CAM26783.1 .
BC057874 mRNA. Translation: AAH57874.1 .
BC079606 mRNA. Translation: AAH79606.1 .
CCDSi CCDS16570.1. [Q924S8-1 ]
CCDS71115.1. [Q924S8-2 ]
RefSeqi NP_001264185.1. NM_001277256.1. [Q924S8-2 ]
NP_277059.1. NM_033524.3. [Q924S8-1 ]
UniGenei Mm.245890.
Mm.392720.
Mm.392726.
Mm.397626.

3D structure databases

ProteinModelPortali Q924S8.
SMRi Q924S8. Positions 13-127.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q924S8. 1 interaction.
MINTi MINT-4997937.

PTM databases

PhosphoSitei Q924S8.

Proteomic databases

MaxQBi Q924S8.
PaxDbi Q924S8.
PRIDEi Q924S8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000028829 ; ENSMUSP00000028829 ; ENSMUSG00000027351 . [Q924S8-1 ]
ENSMUST00000110901 ; ENSMUSP00000106526 ; ENSMUSG00000027351 . [Q924S8-2 ]
GeneIDi 114715.
KEGGi mmu:114715.
UCSCi uc008lri.1. mouse. [Q924S8-1 ]

Organism-specific databases

CTDi 161742.
MGIi MGI:2150016. Spred1.

Phylogenomic databases

eggNOGi NOG277322.
GeneTreei ENSGT00730000110272.
HOGENOMi HOG000220886.
HOVERGENi HBG057556.
InParanoidi Q924S8.
KOi K04703.
OMAi CVTVFKV.
OrthoDBi EOG7T7GV7.
PhylomeDBi Q924S8.
TreeFami TF321411.

Miscellaneous databases

NextBioi 368737.
PROi Q924S8.
SOURCEi Search...

Gene expression databases

Bgeei Q924S8.
Genevestigatori Q924S8.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR023337. KBD.
IPR011993. PH_like_dom.
IPR007875. Sprouty.
IPR000697. WH1/EVH1.
[Graphical view ]
Pfami PF05210. Sprouty. 1 hit.
PF00568. WH1. 1 hit.
[Graphical view ]
PROSITEi PS51488. KBD. 1 hit.
PS51227. SPR. 1 hit.
PS50229. WH1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH RAS, PHOSPHORYLATION, TISSUE SPECIFICITY, FUNCTION.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: NOD.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6.
    Tissue: Brain and Mammary gland.
  5. "Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation."
    Kato R., Nonami A., Taketomi T., Wakioka T., Kuroiwa A., Matsuda Y., Yoshimura A.
    Biochem. Biophys. Res. Commun. 302:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  6. "Expression and subcellular localization of Spred proteins in mouse and human tissues."
    Engelhardt C.M., Bundschu K., Messerschmitt M., Renne T., Walter U., Reinhard M., Schuh K.
    Histochem. Cell Biol. 122:527-538(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Spred-1 negatively regulates interleukin-3-mediated ERK/mitogen-activated protein (MAP) kinase activation in hematopoietic cells."
    Nonami A., Kato R., Taniguchi K., Yoshiga D., Taketomi T., Fukuyama S., Harada M., Sasaki A., Yoshimura A.
    J. Biol. Chem. 279:52543-52551(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  8. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSPRE1_MOUSE
AccessioniPrimary (citable) accession number: Q924S8
Secondary accession number(s): Q3U2W6, Q6PET8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3