Q924A0 (TF7L2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor 7-like 2 Alternative name(s): HMG box transcription factor 4 T-cell-specific transcription factor 4 Short name=T-cell factor 4 Short name=TCF-4 Short name=mTCF-4 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 459 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif CCTTTGATC in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1 By similarity. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. Ref.7 Ref.10 |
| Subunit structure | Interacts with TGFB1I1. Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex. Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1. Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promoters, negatively modulating its transcriptional activity By similarity. Interacts with TNIK. Interacts with ZIPK/DAPK3 By similarity. Interacts with XIAP/BIRC4 and TLE3 By similarity. Interacts with DDIT3/CHOP By similarity. Ref.8 Ref.9 |
| Subcellular location | Nucleus › PML body. Note: Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies By similarity. |
| Tissue specificity | Detected in adult brain and liver, and at lower levels in intestine, with a clear increase from the distal colon to the duodenum. Detected at low levels in heart, lung, kidney, pituitary and testis. |
| Developmental stage | First detected at E10.5. Highly expressed at E13.5-E16.5 in the central nervous system, in particular in the roof of the mesencephalon, at the ditelencephalic junction and in dorsal thalamus. At E13.5, detected at low levels in gastrointestinal epithelia. |
| Post-translational modification | Phosphorylated at Thr-178 and/or Thr-189 by NLK. Phosphorylation by NLK at these sites inhibits DNA-binding by TCF7L2/TCF4, thereby preventing transcriptional activation of target genes of the canonical Wnt/beta-catenin signaling pathway By similarity. Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylation is enhanced by SENP2. Sumoylation/desumoylation regulates TCF7L2/TCF4 transcription activity in the Wnt/beta-catenin signaling pathway without altering interaction with CTNNB1 nor binding to DNA By similarity. |
| Involvement in disease | Constitutive activation and subsequent transactivation of target genes may lead to the maintenance of stem-cell characteristics (cycling and longevity) in cells that should normally undergo terminal differentiation and constitute the primary transforming event in colorectal cancer (CRC). |
| Sequence similarities | Belongs to the TCF/LEF family. Contains 1 HMG box DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Traf1 | P39428 | 6 | EBI-646713,EBI-520123 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q924A0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q924A0-2) The sequence of this isoform differs from the canonical sequence as follows: 268-268: S → SSFLSS 417-459: EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL → GEKKSAFATYKVKAAASAHPLQMEAY | ||||||
| Isoform 3 (identifier: Q924A0-3) The sequence of this isoform differs from the canonical sequence as follows: 237-240: Missing. | ||||||
| Isoform 4 (identifier: Q924A0-4) The sequence of this isoform differs from the canonical sequence as follows: 417-433: Missing. 457-459: CSL → ADANTPKKCR...PLSLVTKSLE | ||||||
| Isoform 5 (identifier: Q924A0-5) The sequence of this isoform differs from the canonical sequence as follows: 161-161: V → VQSPLPCCTQGHACPHFYTPSDFTVSTQVFRDTKSSHSLQKVGEPWYLE 270-459: Missing. | ||||||
| Isoform 6 (identifier: Q924A0-6) The sequence of this isoform differs from the canonical sequence as follows: 270-459: Missing. | ||||||
| Isoform 7 (identifier: Q924A0-7) The sequence of this isoform differs from the canonical sequence as follows: 127-127: T → TLHFQSGSTHYSAYKTIEHQIAIQ 237-240: Missing. 270-459: Missing. | ||||||
| Isoform 8 (identifier: Q924A0-8) The sequence of this isoform differs from the canonical sequence as follows: 268-268: S → SSFLSS 417-459: EHSECFLNPC...QNNWCGPCSL → GERGESGRWR...LGSLFCLCVF | ||||||
| Note: May result from the retention of an intron in the cDNA. | ||||||
| Isoform 9 (identifier: Q924A0-9) Also known as: dnTcf7l2 exon1b/c; The sequence of this isoform differs from the canonical sequence as follows: 1-161: MPQLNGGGGD...ARSPSPAHIV → M | ||||||
| Note: Dominant negative form which cannot bind CTNNB1. Expression is VAX2-dependent. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 459 | 459 | Transcription factor 7-like 2 | PRO_0000048624 | |||||
Regions | |||||||||
| DNA binding | 327 – 395 | 69 | HMG box | ||||||
| Region | 1 – 53 | 53 | CTNNB1-binding | ||||||
| Region | 178 – 372 | 195 | Mediates interaction with MAD2L2 By similarity | ||||||
| Motif | 402 – 408 | 7 | Nuclear localization signal Potential | ||||||
| Compositional bias | 155 – 294 | 140 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 178 | 1 | Phosphothreonine; by NLK By similarity | ||||||
| Modified residue | 189 | 1 | Phosphothreonine; by NLK By similarity | ||||||
| Cross-link | 297 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 161 | 161 | MPQLN…PAHIV → M in isoform 9. | VSP_043205 | |||||
| Alternative sequence | 127 | 1 | T → TLHFQSGSTHYSAYKTIEHQ IAIQ in isoform 7. | VSP_006973 | |||||
| Alternative sequence | 161 | 1 | V → VQSPLPCCTQGHACPHFYTP SDFTVSTQVFRDTKSSHSLQ KVGEPWYLE in isoform 5. | VSP_006974 | |||||
| Alternative sequence | 237 – 240 | 4 | Missing in isoform 3 and isoform 7. | VSP_006975 | |||||
| Alternative sequence | 268 | 1 | S → SSFLSS in isoform 2 and isoform 8. | VSP_006976 | |||||
| Alternative sequence | 270 – 459 | 190 | Missing in isoform 5, isoform 6 and isoform 7. | VSP_006977 | |||||
| Alternative sequence | 417 – 459 | 43 | EHSEC…GPCSL → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 2. | VSP_006979 | |||||
| Alternative sequence | 417 – 459 | 43 | EHSEC…GPCSL → GERGESGRWRLEDHSYVRLP SGGGRRNPRPGHCGEPILGS LFCLCVF in isoform 8. | VSP_006980 | |||||
| Alternative sequence | 417 – 433 | 17 | Missing in isoform 4. | VSP_006978 | |||||
| Alternative sequence | 457 – 459 | 3 | CSL → ADANTPKKCRALFGLDRQTL WCKPCRRKKKCVRYIQGEGS CLSPPSSDGSLLDSPPPSPH LLGSPPQDAKSQTEQTQPLS LSLKPDPLAHLSMMPPPPAL LLAEAAHGKASALCPNGALD LPPAALQPSMVPSSSLAQPS TSSLHSHNSLAGTQPQPLSL VTKSLE in isoform 4. | VSP_006981 | |||||
Experimental info | |||||||||
| Sequence conflict | 57 | 1 | D → N in AAD16967. Ref.2 | ||||||
| Sequence conflict | 57 | 1 | D → N in AAK77488. Ref.3 | ||||||
| Sequence conflict | 57 | 1 | D → N in AAK77489. Ref.3 | ||||||
| Sequence conflict | 57 | 1 | D → N in AAK77490. Ref.3 | ||||||
| Sequence conflict | 236 | 1 | W → R in AAL58534. Ref.4 | ||||||
| Sequence conflict | 410 | 1 | K → Q in AAD16968. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two members of the Tcf family implicated in Wnt/b-catenin signaling during embryogenesis in the mouse." Korinek V., Barker N., Willert K., Molenaar M., Roose J., Wagenaar G., Markman M., Lamers W., Destree O., Clevers H. Mol. Cell. Biol. 18:1248-1256(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Embryo. |
| [2] | "A possible role for the high mobility group box transcription factor Tcf-4 in vertebrate gut epithelial cell differentiation." Lee Y.J., Swencki B., Shoichet S., Shivdasani R.A. J. Biol. Chem. 274:1566-1572(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4). Strain: ICR. Tissue: Fetal intestine. |
| [3] | "Identification of members of the Wnt signaling pathway in the embryonic pituitary gland." Douglas K.R., Brinkmeier M.L., Kennell J.A., Eswara P., Harrison T.A., Patrianakos A.I., Sprecher B.S., Potok M.A., Lyons R.H. Jr., MacDougald O.A., Camper S.A. Mamm. Genome 12:843-851(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 6 AND 7), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 5). Strain: C57BL/6J and CD-1. Tissue: Pituitary. |
| [4] | "A novel isoform of the HMG transcription factor Tcf4." Bayarsaihan D. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8). |
| [5] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). Strain: C57BL/6J. Tissue: Head. |
| [6] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [7] | "Depletion of epithelial stem-cell compartments in the small intestine of mice lacking Tcf-4." Korinek V., Barker N., Moerer P., van Donselaar E., Huls G., Peters P.J., Clevers H. Nat. Genet. 19:379-383(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "HIC-5 is a novel repressor of lymphoid enhancer factor/T-cell factor-driven transcription." Ghogomu S.M., van Venrooy S., Ritthaler M., Wedlich D., Gradl D. J. Biol. Chem. 281:1755-1764(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TGFB1I1. |
| [9] | "The kinase TNIK is an essential activator of Wnt target genes." Mahmoudi T., Li V.S.W., Ng S.S., Taouatas N., Vries R.G.J., Mohammed S., Heck A.J., Clevers H. EMBO J. 28:3329-3340(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TNIK AND CTNNB1. |
| [10] | "A novel mechanism for the transcriptional regulation of Wnt signaling in development." Vacik T., Stubbs J.L., Lemke G. Genes Dev. 25:1783-1795(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ223070 mRNA. Translation: CAA11071.1. AF107298 mRNA. Translation: AAD16967.1. AF107299 mRNA. Translation: AAD16968.1. AF363722 Genomic DNA. Translation: AAK77485.1. AF363722 Genomic DNA. Translation: AAK77486.1. AF363724 mRNA. Translation: AAK77488.1. AF363725 mRNA. Translation: AAK77489.1. AF363726 mRNA. Translation: AAK77490.1. AY072035 mRNA. Translation: AAL58534.1. AK048536 mRNA. Translation: BAC33366.1. AC118695 Genomic DNA. No translation available. AC137148 Genomic DNA. No translation available. AC157916 Genomic DNA. No translation available. |
| IPI | IPI00129307. IPI00224936. IPI00224938. IPI00224939. IPI00224941. IPI00830945. IPI00831494. IPI00831648. IPI00918384. |
| RefSeq | NP_001136390.1. NM_001142918.1. NP_001136393.1. NM_001142921.1. NP_001136396.1. NM_001142924.1. |
| UniGene | Mm.139815. |
3D structure databases | |
| ProteinModelPortal | Q924A0. |
| SMR | Q924A0. Positions 12-49, 326-401. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-40920N. |
| IntAct | Q924A0. 1 interaction. |
| MINT | MINT-421706. |
PTM databases | |
| PhosphoSite | Q924A0. |
Proteomic databases | |
| PRIDE | Q924A0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000111646; ENSMUSP00000107273; ENSMUSG00000024985. ENSMUST00000111649; ENSMUSP00000107276; ENSMUSG00000024985. ENSMUST00000111651; ENSMUSP00000107278; ENSMUSG00000024985. ENSMUST00000111652; ENSMUSP00000107279; ENSMUSG00000024985. ENSMUST00000111659; ENSMUSP00000107287; ENSMUSG00000024985. |
| GeneID | 21416. |
| KEGG | mmu:21416. |
| UCSC | uc008hya.2. mouse. uc008hyb.2. mouse. uc008hyh.2. mouse. uc008hyk.2. mouse. uc008hyl.2. mouse. |
Organism-specific databases | |
| CTD | 6934. |
| MGI | MGI:1202879. Tcf7l2. |
Phylogenomic databases | |
| eggNOG | NOG252916. |
| GeneTree | ENSGT00390000009964. |
| HOGENOM | HOG000116032. |
| HOVERGEN | HBG000419. |
| KO | K04491. |
| OrthoDB | EOG43XV3J. |
Gene expression databases | |
| ArrayExpress | Q924A0. |
| Bgee | Q924A0. |
| CleanEx | MM_TCF4. |
| Genevestigator | Q924A0. |
| GermOnline | ENSMUSG00000024985. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.30.10. 1 hit. |
| InterPro | IPR013558. CTNNB1-bd_N. IPR009071. HMG_box_dom. IPR024940. TCF/LEF. [Graphical view] |
| PANTHER | PTHR10373. PTHR10373. 1 hit. |
| Pfam | PF08347. CTNNB1_binding. 1 hit. PF00505. HMG_box. 1 hit. [Graphical view] |
| SMART | SM00398. HMG. 1 hit. [Graphical view] |
| SUPFAM | SSF47095. HMG-box. 1 hit. |
| PROSITE | PS50118. HMG_BOX_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TCF7L2. mouse. |
| NextBio | 300716. |
| SOURCE | Search... |
Entry information
| Entry name | TF7L2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q924A0 Secondary accession number(s): O70574 Q9Z0V4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
