Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

Msra

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).By similarity

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

  • peptide-methionine (S)-S-oxide reductase activity Source: RGD

GO - Biological processi

  • aging Source: RGD
  • protein repair Source: InterPro
  • response to oxidative stress Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Enzyme and pathway databases

BRENDAi1.8.4.11. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:Msra
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi70979. Msra.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: RGD
  • mitochondrion Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3509605.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 20MitochondrionBy similarityAdd BLAST20
ChainiPRO_000013862821 – 233Mitochondrial peptide methionine sulfoxide reductaseAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei104N6-acetyllysine; alternateBy similarity1
Modified residuei104N6-succinyllysine; alternateBy similarity1
Modified residuei183N6-acetyllysine; alternateBy similarity1
Modified residuei183N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PRIDEiQ923M1.

PTM databases

iPTMnetiQ923M1.
PhosphoSitePlusiQ923M1.

Expressioni

Tissue specificityi

Isoform 2 is ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSRNOG00000012440.

Structurei

3D structure databases

ProteinModelPortaliQ923M1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ923M1.
KOiK07304.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q923M1-1) [UniParc]FASTAAdd to basket
Also known as: mito-MSRA

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSASRRTLQ LLSSSIPVRM MGDSSSKVIS AEEALPGRTE SIPVAAKHHV
60 70 80 90 100
SGNRTVEPFP EGTQMAVFGM GCFWGAERKF WLLKGVYSTQ VGFAGGYTRN
110 120 130 140 150
PTYKEVCSEK TGHAEVVRVV YRPEHVSFEE LLKVFWENHD PTQGMRQGND
160 170 180 190 200
CGTQYRSAVY PTSAVQMEAA LKSKEEYQKV LSKHGFGPIT TDIREGQVFY
210 220 230
YAEDYHQQYL SKNPDGYCGL GGTGVSCPTA IKK
Note: Mitochondrial.
Length:233
Mass (Da):25,851
Last modified:December 1, 2001 - v1
Checksum:i6F895BD4FEBCB18C
GO
Isoform 2 (identifier: Q923M1-3) [UniParc]FASTAAdd to basket
Also known as: MSRA2a

The sequence of this isoform differs from the canonical sequence as follows:
     46-46: A → AALPTPSLSPNQKLNYFVWKEVPGKHSWP

Note: Mitochondrial. Enzymatically active.
Show »
Length:261
Mass (Da):29,055
Checksum:i62DCC266CA7529B5
GO
Isoform 3 (identifier: Q923M1-4) [UniParc]FASTAAdd to basket
Also known as: MSRA2b1, MSRA2b2

The sequence of this isoform differs from the canonical sequence as follows:
     47-56: KHHVSGNRTV → SCHPKLHPSN
     57-233: Missing.

Note: Mitochondrial. No enzymatic activity.
Show »
Length:56
Mass (Da):5,933
Checksum:i408916C56261E612
GO
Isoform 4 (identifier: Q923M1-2) [UniParc]FASTAAdd to basket
Also known as: cyto-MSRA

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MLSASRRTLQLLSSSIPVRMMGDSSSKVISAEEALPGRTESIPVAA → MEQQPQA

Note: Cytoplasmic. No experimental confirmation available.
Show »
Length:194
Mass (Da):21,851
Checksum:iF657A693318E6497
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414131 – 46MLSAS…IPVAA → MEQQPQA in isoform 4. CuratedAdd BLAST46
Alternative sequenceiVSP_04141046A → AALPTPSLSPNQKLNYFVWK EVPGKHSWP in isoform 2. 1 Publication1
Alternative sequenceiVSP_04141147 – 56KHHVSGNRTV → SCHPKLHPSN in isoform 3. 1 Publication10
Alternative sequenceiVSP_04141257 – 233Missing in isoform 3. 1 PublicationAdd BLAST177

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY005464 mRNA. Translation: AAF99392.1.
BC087009 mRNA. Translation: AAH87009.1.
DQ989019 mRNA. Translation: ABL73891.1.
DQ989020 mRNA. Translation: ABL73892.1.
DQ989021 mRNA. Translation: ABL73893.1.
RefSeqiNP_445759.1. NM_053307.2. [Q923M1-1]
XP_008768967.2. XM_008770745.2. [Q923M1-1]
UniGeneiRn.163306.

Genome annotation databases

GeneIDi29447.
KEGGirno:29447.
UCSCiRGD:70979. rat. [Q923M1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY005464 mRNA. Translation: AAF99392.1.
BC087009 mRNA. Translation: AAH87009.1.
DQ989019 mRNA. Translation: ABL73891.1.
DQ989020 mRNA. Translation: ABL73892.1.
DQ989021 mRNA. Translation: ABL73893.1.
RefSeqiNP_445759.1. NM_053307.2. [Q923M1-1]
XP_008768967.2. XM_008770745.2. [Q923M1-1]
UniGeneiRn.163306.

3D structure databases

ProteinModelPortaliQ923M1.
ModBaseiSearch...
MobiDBiSearch...

Chemistry databases

ChEMBLiCHEMBL3509605.

PTM databases

iPTMnetiQ923M1.
PhosphoSitePlusiQ923M1.

Proteomic databases

PRIDEiQ923M1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi29447.
KEGGirno:29447.
UCSCiRGD:70979. rat. [Q923M1-1]

Organism-specific databases

CTDi4482.
RGDi70979. Msra.

Phylogenomic databases

HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ923M1.
KOiK07304.

Enzyme and pathway databases

BRENDAi1.8.4.11. 5301.

Miscellaneous databases

PROiQ923M1.

Gene expression databases

BgeeiENSRNOG00000012440.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMSRA_RAT
AccessioniPrimary (citable) accession number: Q923M1
Secondary accession number(s): A9LAT3, A9LAT4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.