Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

Msra

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).By similarity

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

  • peptide-methionine (S)-S-oxide reductase activity Source: RGD

GO - Biological processi

  • aging Source: RGD
  • protein repair Source: InterPro
  • response to oxidative stress Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Enzyme and pathway databases

BRENDAi1.8.4.11. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:Msra
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi70979. Msra.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: RGD
  • mitochondrion Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL3509605.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2020MitochondrionBy similarityAdd
BLAST
Chaini21 – 233213Mitochondrial peptide methionine sulfoxide reductasePRO_0000138628Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei104 – 1041N6-acetyllysine; alternateBy similarity
Modified residuei104 – 1041N6-succinyllysine; alternateBy similarity
Modified residuei183 – 1831N6-acetyllysine; alternateBy similarity
Modified residuei183 – 1831N6-succinyllysine; alternateBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

PRIDEiQ923M1.

PTM databases

iPTMnetiQ923M1.

Expressioni

Tissue specificityi

Isoform 2 is ubiquitously expressed.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ923M1.
SMRiQ923M1. Positions 28-228.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ923M1.
KOiK07304.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q923M1-1) [UniParc]FASTAAdd to basket

Also known as: mito-MSRA

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSASRRTLQ LLSSSIPVRM MGDSSSKVIS AEEALPGRTE SIPVAAKHHV
60 70 80 90 100
SGNRTVEPFP EGTQMAVFGM GCFWGAERKF WLLKGVYSTQ VGFAGGYTRN
110 120 130 140 150
PTYKEVCSEK TGHAEVVRVV YRPEHVSFEE LLKVFWENHD PTQGMRQGND
160 170 180 190 200
CGTQYRSAVY PTSAVQMEAA LKSKEEYQKV LSKHGFGPIT TDIREGQVFY
210 220 230
YAEDYHQQYL SKNPDGYCGL GGTGVSCPTA IKK
Note: Mitochondrial.
Length:233
Mass (Da):25,851
Last modified:December 1, 2001 - v1
Checksum:i6F895BD4FEBCB18C
GO
Isoform 2 (identifier: Q923M1-3) [UniParc]FASTAAdd to basket

Also known as: MSRA2a

The sequence of this isoform differs from the canonical sequence as follows:
     46-46: A → AALPTPSLSPNQKLNYFVWKEVPGKHSWP

Note: Mitochondrial. Enzymatically active.
Show »
Length:261
Mass (Da):29,055
Checksum:i62DCC266CA7529B5
GO
Isoform 3 (identifier: Q923M1-4) [UniParc]FASTAAdd to basket

Also known as: MSRA2b1, MSRA2b2

The sequence of this isoform differs from the canonical sequence as follows:
     47-56: KHHVSGNRTV → SCHPKLHPSN
     57-233: Missing.

Note: Mitochondrial. No enzymatic activity.
Show »
Length:56
Mass (Da):5,933
Checksum:i408916C56261E612
GO
Isoform 4 (identifier: Q923M1-2) [UniParc]FASTAAdd to basket

Also known as: cyto-MSRA

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MLSASRRTLQLLSSSIPVRMMGDSSSKVISAEEALPGRTESIPVAA → MEQQPQA

Note: Cytoplasmic. No experimental confirmation available.
Show »
Length:194
Mass (Da):21,851
Checksum:iF657A693318E6497
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646MLSAS…IPVAA → MEQQPQA in isoform 4. CuratedVSP_041413Add
BLAST
Alternative sequencei46 – 461A → AALPTPSLSPNQKLNYFVWK EVPGKHSWP in isoform 2. 1 PublicationVSP_041410
Alternative sequencei47 – 5610KHHVSGNRTV → SCHPKLHPSN in isoform 3. 1 PublicationVSP_041411
Alternative sequencei57 – 233177Missing in isoform 3. 1 PublicationVSP_041412Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY005464 mRNA. Translation: AAF99392.1.
BC087009 mRNA. Translation: AAH87009.1.
DQ989019 mRNA. Translation: ABL73891.1.
DQ989020 mRNA. Translation: ABL73892.1.
DQ989021 mRNA. Translation: ABL73893.1.
RefSeqiNP_445759.1. NM_053307.2. [Q923M1-1]
UniGeneiRn.163306.

Genome annotation databases

GeneIDi29447.
KEGGirno:29447.
UCSCiRGD:70979. rat. [Q923M1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY005464 mRNA. Translation: AAF99392.1.
BC087009 mRNA. Translation: AAH87009.1.
DQ989019 mRNA. Translation: ABL73891.1.
DQ989020 mRNA. Translation: ABL73892.1.
DQ989021 mRNA. Translation: ABL73893.1.
RefSeqiNP_445759.1. NM_053307.2. [Q923M1-1]
UniGeneiRn.163306.

3D structure databases

ProteinModelPortaliQ923M1.
SMRiQ923M1. Positions 28-228.
ModBaseiSearch...
MobiDBiSearch...

Chemistry

ChEMBLiCHEMBL3509605.

PTM databases

iPTMnetiQ923M1.

Proteomic databases

PRIDEiQ923M1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi29447.
KEGGirno:29447.
UCSCiRGD:70979. rat. [Q923M1-1]

Organism-specific databases

CTDi4482.
RGDi70979. Msra.

Phylogenomic databases

HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ923M1.
KOiK07304.

Enzyme and pathway databases

BRENDAi1.8.4.11. 5301.

Miscellaneous databases

NextBioi609209.
PROiQ923M1.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Rat peptide methionine sulphoxide reductase: cloning of the cDNA, and down-regulation of gene expression and enzyme activity during aging."
    Petropoulos I., Mary J., Perichon M., Friguet B.
    Biochem. J. 355:819-825(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  3. "Identification of a new functional splice variant of the enzyme methionine sulphoxide reductase A (MSRA) expressed in rat vascular smooth muscle cells."
    Haenold R., Wassef R., Hansel A., Heinemann S.H., Hoshi T.
    Free Radic. Res. 41:1233-1245(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-233 (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 20-233 (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    Tissue: Smooth muscle.
  4. "Subcellular localization of methionine sulphoxide reductase A (MsrA): evidence for mitochondrial and cytosolic isoforms in rat liver cells."
    Vougier S., Mary J., Friguet B.
    Biochem. J. 373:531-537(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 28-47, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
    Tissue: Liver.

Entry informationi

Entry nameiMSRA_RAT
AccessioniPrimary (citable) accession number: Q923M1
Secondary accession number(s): A9LAT3, A9LAT4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: December 1, 2001
Last modified: May 11, 2016
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.