Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-like protein family member 11B

Gene

Rasl11b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi39 – 468GTPBy similarity
Nucleotide bindingi86 – 938GTPBy similarity
Nucleotide bindingi151 – 1544GTPBy similarity

GO - Molecular functioni

  • GTP binding Source: UniProtKB-KW
  • transforming growth factor beta receptor binding Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-like protein family member 11B
Gene namesi
Name:Rasl11bImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1916189. Rasl11b.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 247247Ras-like protein family member 11BPRO_0000308366Add
BLAST

Proteomic databases

PaxDbiQ922H7.
PRIDEiQ922H7.

PTM databases

PhosphoSiteiQ922H7.

Expressioni

Gene expression databases

BgeeiQ922H7.
CleanExiMM_RASL11B.
GenevisibleiQ922H7. MM.

Interactioni

GO - Molecular functioni

  • transforming growth factor beta receptor binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000053389.

Structurei

3D structure databases

ProteinModelPortaliQ922H7.
SMRiQ922H7. Positions 33-204.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni28 – 245218Small GTPase-likeAdd
BLAST

Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Sequence analysis

Phylogenomic databases

eggNOGiKOG0395. Eukaryota.
COG1100. LUCA.
GeneTreeiENSGT00780000121877.
HOGENOMiHOG000233973.
HOVERGENiHBG108422.
InParanoidiQ922H7.
KOiK07853.
OMAiIQVHENG.
OrthoDBiEOG70W3F5.
PhylomeDBiQ922H7.
TreeFamiTF318030.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERiPTHR24070. PTHR24070. 1 hit.
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51421. RAS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q922H7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLIQNMCTI AEYPAPGSTA ADCCLGAAGR RLVKIAVVGA SGVGKTALVV
60 70 80 90 100
RFLTKRFIGD YERNAGNLYT RQVHIEGETL AIQVQDTPGI QVHENGLSCS
110 120 130 140 150
EQLNRCIRWA DAVVLVFSIT DHKSYELISQ LHQHVQQLHP GTRLPVVLVA
160 170 180 190 200
NKADLLHVKQ VDPQLGLQLA SMLGCSFYEV SVSENYNDVY NAFHVLCKEV
210 220 230 240
SPKQQPSSTP EKRRTSLIPR PKSPNMQDLK RRFKQALSAK VRTVTSV
Length:247
Mass (Da):27,362
Last modified:December 1, 2001 - v1
Checksum:i58B70AF005718538
GO
Isoform 21 Publication (identifier: Q922H7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: Missing.
     60-90: DYERNAGNLYTRQVHIEGETLAIQVQDTPGI → MKGSFELRDVLWPELSAVPTASCSPCSPSSP

Note: No experimental confirmation available.Curated
Show »
Length:188
Mass (Da):21,033
Checksum:iCB2FE5086990A8DA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti224 – 2241P → L in BAB23353 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5959Missing in isoform 2. 1 PublicationVSP_052585Add
BLAST
Alternative sequencei60 – 9031DYERN…DTPGI → MKGSFELRDVLWPELSAVPT ASCSPCSPSSP in isoform 2. 1 PublicationVSP_052586Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004534 mRNA. Translation: BAB23353.1.
BC008101 mRNA. Translation: AAH08101.1.
BC083068 mRNA. Translation: AAH83068.1.
BK001707 mRNA. Translation: DAA02249.1.
CCDSiCCDS39113.1. [Q922H7-1]
RefSeqiNP_081154.1. NM_026878.1. [Q922H7-1]
UniGeneiMm.293316.

Genome annotation databases

EnsembliENSMUST00000051937; ENSMUSP00000053389; ENSMUSG00000049907. [Q922H7-1]
GeneIDi68939.
KEGGimmu:68939.
UCSCiuc008xtj.1. mouse. [Q922H7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004534 mRNA. Translation: BAB23353.1.
BC008101 mRNA. Translation: AAH08101.1.
BC083068 mRNA. Translation: AAH83068.1.
BK001707 mRNA. Translation: DAA02249.1.
CCDSiCCDS39113.1. [Q922H7-1]
RefSeqiNP_081154.1. NM_026878.1. [Q922H7-1]
UniGeneiMm.293316.

3D structure databases

ProteinModelPortaliQ922H7.
SMRiQ922H7. Positions 33-204.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000053389.

PTM databases

PhosphoSiteiQ922H7.

Proteomic databases

PaxDbiQ922H7.
PRIDEiQ922H7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000051937; ENSMUSP00000053389; ENSMUSG00000049907. [Q922H7-1]
GeneIDi68939.
KEGGimmu:68939.
UCSCiuc008xtj.1. mouse. [Q922H7-1]

Organism-specific databases

CTDi65997.
MGIiMGI:1916189. Rasl11b.

Phylogenomic databases

eggNOGiKOG0395. Eukaryota.
COG1100. LUCA.
GeneTreeiENSGT00780000121877.
HOGENOMiHOG000233973.
HOVERGENiHBG108422.
InParanoidiQ922H7.
KOiK07853.
OMAiIQVHENG.
OrthoDBiEOG70W3F5.
PhylomeDBiQ922H7.
TreeFamiTF318030.

Miscellaneous databases

NextBioi328227.
PROiQ922H7.
SOURCEiSearch...

Gene expression databases

BgeeiQ922H7.
CleanExiMM_RASL11B.
GenevisibleiQ922H7. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERiPTHR24070. PTHR24070. 1 hit.
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51421. RAS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6JImported.
    Tissue: EmbryoImported.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6JImported and FVB/NImported.
    Tissue: Mammary tumorImported and Olfactory epitheliumImported.
  3. "Rasl11a, member of a novel small monomeric GTPase gene family, is differentially expressed in prostate tumors."
    Louro R., Nakaya H.I., Paquola A.C.M., Martins E.A.L., da Silva A.M., Verjovski-Almeida S., Reis E.M.
    Biochem. Biophys. Res. Commun. 316:618-627(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION (ISOFORM 1).

Entry informationi

Entry nameiRSLBB_MOUSE
AccessioniPrimary (citable) accession number: Q922H7
Secondary accession number(s): Q9D0S0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 1, 2001
Last modified: January 20, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.