Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 6 regulatory subunit 3

Gene

Ppp6r3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. May have an important role in maintaining immune self-tolerance (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 6 regulatory subunit 3
Alternative name(s):
SAPS domain family member 3
Gene namesi
Name:Ppp6r3
Synonyms:D19Ertd703e, Kiaa1558, Pp6r3, Saps3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1921807. Ppp6r3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 844844Serine/threonine-protein phosphatase 6 regulatory subunit 3PRO_0000046101Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei315 – 3151PhosphoserineCombined sources
Modified residuei550 – 5501PhosphoserineCombined sources
Modified residuei588 – 5881PhosphoserineCombined sources
Modified residuei693 – 6931PhosphoserineBy similarity
Modified residuei820 – 8201PhosphothreonineCombined sources
Modified residuei824 – 8241PhosphoserineCombined sources
Isoform 3 (identifier: Q922D4-3)
Modified residuei525 – 5251PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ922D4.
MaxQBiQ922D4.
PaxDbiQ922D4.
PRIDEiQ922D4.

PTM databases

iPTMnetiQ922D4.
PhosphoSiteiQ922D4.

Expressioni

Tissue specificityi

Strongest expression observed in lung, spleen, bladder and liver and weaker levels present in brain, heart, kidney, skeletal muscle and pancreas.1 Publication

Gene expression databases

BgeeiQ922D4.
CleanExiMM_SAPS3.
ExpressionAtlasiQ922D4. baseline and differential.
GenevisibleiQ922D4. MM.

Interactioni

Subunit structurei

Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP6C and ANKRD28 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi206340. 1 interaction.
IntActiQ922D4. 18 interactions.
MINTiMINT-4122756.
STRINGi10090.ENSMUSP00000109630.

Structurei

3D structure databases

ProteinModelPortaliQ922D4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SAPS family.Curated

Phylogenomic databases

eggNOGiKOG2073. Eukaryota.
ENOG410XRM1. LUCA.
GeneTreeiENSGT00390000009899.
HOVERGENiHBG069733.
InParanoidiQ922D4.
KOiK15501.
PhylomeDBiQ922D4.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR007587. SAPS.
[Graphical view]
PANTHERiPTHR12634. PTHR12634. 1 hit.
PfamiPF04499. SAPS. 2 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q922D4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFWKFDLHSS SHIDTLLERE DVTLKELMDE EDVLQECKAQ NRKLIEFLLK
60 70 80 90 100
AECLEDLVSF IIEEPPQDMD EKIRYKYPNI SCELLTSDVS QMNDRLGEDE
110 120 130 140 150
SLLMKLYSFL LNESPLNPLL ASFFSKVLSI LISRKPEQIV DFLKKKRDFV
160 170 180 190 200
DLIIKHIGTS AIMDLLLRLL TCIEPPQPRQ DVLNWLNEER IIQRLVEIVH
210 220 230 240 250
PSQEEDRHSN ASQSLCEIVR LSRDQMLQVQ NSTEPDPLLA TLEKQEIIEQ
260 270 280 290 300
LLSNIFHKEK NESAIVSAIQ ILLTLLETRR PTFEGHIEIC PPGMSHSACS
310 320 330 340 350
VNKSVLEAIR GRLGSFHELL LEPPKKSVMK TTWGILDPPV GNTRLNVIRL
360 370 380 390 400
ISSLLQTNTS SINGDLMELN SIGVILDMFF KYTWNNFLHT QVEICIALIL
410 420 430 440 450
ASPFENAENG TITDQDSTGD NLLLKHLFQK CQLIERILEA WDTNEKKQAE
460 470 480 490 500
GGRRHGYMGH LTRIANCIVH STDKGPNSAL VQQLIKDLPD EVRERWETFC
510 520 530 540 550
TNSLGETNKR NTVDLAFSDY QMQQMTSNFI DQFGFNDEKF ADQDDIGNVS
560 570 580 590 600
FDRVSDINFT LNTNESGNIA LFEACCKERI QQFDDGGSDE EDIWEEKHIA
610 620 630 640 650
FTPESQRRSS SGSTDSEEST DSEEEDGAKQ DLFESSSANT EDKMEVDLNE
660 670 680 690 700
PPTWSANFDV PMETTHGAPL DSVGSDVWST EEPMPTKETG WASFSEFTSS
710 720 730 740 750
LSTKESLRSN SPVEMETSTE SVDPLTPGAA ALATQPEAPG SMAMEASSDG
760 770 780 790 800
EEDAESTDKV TETVMNGGMK ETLSLTVDAK TETAVFKSEE EKLSTSQDAA
810 820 830 840
CKDAEETPEP AEAKCTAPLT PSSSPEQRTD QPSMPSDPSV NGPV
Length:844
Mass (Da):94,653
Last modified:December 1, 2001 - v1
Checksum:i1C70ED57ECEF1D45
GO
Isoform 2 (identifier: Q922D4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     516-532: Missing.

Show »
Length:827
Mass (Da):92,617
Checksum:iB0662791EA23E430
GO
Isoform 3 (identifier: Q922D4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     516-548: AFSDYQMQQMTSNFIDQFGFNDEKFADQDDIGN → VTTCHIHSSSDDEIDFKDTGFSQDSSLQQVSHT
     549-844: Missing.

Show »
Length:548
Mass (Da):62,653
Checksum:iF7539F7CDAD9DD16
GO
Isoform 4 (identifier: Q922D4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     487-497: DLPDEVRERWE → GKLVNNLITCV
     498-844: Missing.

Show »
Length:497
Mass (Da):56,753
Checksum:i4014B24F3B130679
GO

Sequence cautioni

The sequence BAC98202.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei487 – 49711DLPDEVRERWE → GKLVNNLITCV in isoform 4. 1 PublicationVSP_017148Add
BLAST
Alternative sequencei498 – 844347Missing in isoform 4. 1 PublicationVSP_017149Add
BLAST
Alternative sequencei516 – 54833AFSDY…DDIGN → VTTCHIHSSSDDEIDFKDTG FSQDSSLQQVSHT in isoform 3. 1 PublicationVSP_017146Add
BLAST
Alternative sequencei516 – 53217Missing in isoform 2. 1 PublicationVSP_017145Add
BLAST
Alternative sequencei549 – 844296Missing in isoform 3. 1 PublicationVSP_017147Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129392 mRNA. Translation: BAC98202.1. Different initiation.
AK018652 mRNA. Translation: BAB31326.1.
AK035236 mRNA. Translation: BAC28993.1.
AK088526 mRNA. Translation: BAC40403.1.
BC008529 mRNA. Translation: AAH08529.1.
CCDSiCCDS29397.1. [Q922D4-1]
CCDS50340.1. [Q922D4-2]
RefSeqiNP_001157631.1. NM_001164159.1. [Q922D4-2]
NP_083275.1. NM_028999.1.
NP_083732.1. NM_029456.2. [Q922D4-1]
XP_006531859.1. XM_006531796.1. [Q922D4-2]
UniGeneiMm.284686.

Genome annotation databases

EnsembliENSMUST00000025846; ENSMUSP00000025846; ENSMUSG00000024908. [Q922D4-1]
ENSMUST00000172362; ENSMUSP00000131084; ENSMUSG00000024908. [Q922D4-2]
GeneIDi52036.
KEGGimmu:52036.
UCSCiuc008fwk.3. mouse. [Q922D4-1]
uc008fwl.3. mouse. [Q922D4-2]
uc008fwm.2. mouse. [Q922D4-3]
uc008fwo.2. mouse. [Q922D4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129392 mRNA. Translation: BAC98202.1. Different initiation.
AK018652 mRNA. Translation: BAB31326.1.
AK035236 mRNA. Translation: BAC28993.1.
AK088526 mRNA. Translation: BAC40403.1.
BC008529 mRNA. Translation: AAH08529.1.
CCDSiCCDS29397.1. [Q922D4-1]
CCDS50340.1. [Q922D4-2]
RefSeqiNP_001157631.1. NM_001164159.1. [Q922D4-2]
NP_083275.1. NM_028999.1.
NP_083732.1. NM_029456.2. [Q922D4-1]
XP_006531859.1. XM_006531796.1. [Q922D4-2]
UniGeneiMm.284686.

3D structure databases

ProteinModelPortaliQ922D4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206340. 1 interaction.
IntActiQ922D4. 18 interactions.
MINTiMINT-4122756.
STRINGi10090.ENSMUSP00000109630.

PTM databases

iPTMnetiQ922D4.
PhosphoSiteiQ922D4.

Proteomic databases

EPDiQ922D4.
MaxQBiQ922D4.
PaxDbiQ922D4.
PRIDEiQ922D4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025846; ENSMUSP00000025846; ENSMUSG00000024908. [Q922D4-1]
ENSMUST00000172362; ENSMUSP00000131084; ENSMUSG00000024908. [Q922D4-2]
GeneIDi52036.
KEGGimmu:52036.
UCSCiuc008fwk.3. mouse. [Q922D4-1]
uc008fwl.3. mouse. [Q922D4-2]
uc008fwm.2. mouse. [Q922D4-3]
uc008fwo.2. mouse. [Q922D4-4]

Organism-specific databases

CTDi55291.
MGIiMGI:1921807. Ppp6r3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG2073. Eukaryota.
ENOG410XRM1. LUCA.
GeneTreeiENSGT00390000009899.
HOVERGENiHBG069733.
InParanoidiQ922D4.
KOiK15501.
PhylomeDBiQ922D4.

Enzyme and pathway databases

ReactomeiR-MMU-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.

Miscellaneous databases

ChiTaRSiPpp6r3. mouse.
NextBioi308408.
PROiQ922D4.
SOURCEiSearch...

Gene expression databases

BgeeiQ922D4.
CleanExiMM_SAPS3.
ExpressionAtlasiQ922D4. baseline and differential.
GenevisibleiQ922D4. MM.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR007587. SAPS.
[Graphical view]
PANTHERiPTHR12634. PTHR12634. 1 hit.
PfamiPF04499. SAPS. 2 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Cecum, Thymus and Urinary bladder.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-588, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  5. "Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon."
    Stefansson B., Brautigan D.L.
    J. Biol. Chem. 281:22624-22634(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-550; THR-820 AND SER-824, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
    Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
    J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315; SER-550; SER-588; THR-820 AND SER-824, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-525 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiPP6R3_MOUSE
AccessioniPrimary (citable) accession number: Q922D4
Secondary accession number(s): Q6ZPM9, Q8BTW6, Q9D2X9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: December 1, 2001
Last modified: March 16, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.