Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 6 regulatory subunit 3

Gene

Ppp6r3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. May have an important role in maintaining immune self-tolerance (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-204005 COPII-mediated vesicle transport

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 6 regulatory subunit 3
Alternative name(s):
SAPS domain family member 3
Gene namesi
Name:Ppp6r3
Synonyms:D19Ertd703e, Kiaa1558, Pp6r3, Saps3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1921807 Ppp6r3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000461011 – 844Serine/threonine-protein phosphatase 6 regulatory subunit 3Add BLAST844

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei315PhosphoserineCombined sources1
Modified residuei550PhosphoserineCombined sources1
Modified residuei588PhosphoserineCombined sources1
Modified residuei602PhosphothreonineBy similarity1
Modified residuei605PhosphoserineBy similarity1
Modified residuei693PhosphoserineBy similarity1
Modified residuei820PhosphothreonineCombined sources1
Modified residuei824PhosphoserineCombined sources1
Isoform 3 (identifier: Q922D4-3)
Modified residuei525PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ922D4
PeptideAtlasiQ922D4
PRIDEiQ922D4

PTM databases

iPTMnetiQ922D4
PhosphoSitePlusiQ922D4

Expressioni

Tissue specificityi

Strongest expression observed in lung, spleen, bladder and liver and weaker levels present in brain, heart, kidney, skeletal muscle and pancreas.1 Publication

Gene expression databases

BgeeiENSMUSG00000024908
CleanExiMM_SAPS3
ExpressionAtlasiQ922D4 baseline and differential
GenevisibleiQ922D4 MM

Interactioni

Subunit structurei

Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP6C and ANKRD28 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi206340, 3 interactors
IntActiQ922D4, 18 interactors
MINTiQ922D4
STRINGi10090.ENSMUSP00000109630

Structurei

3D structure databases

ProteinModelPortaliQ922D4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SAPS family.Curated

Phylogenomic databases

eggNOGiKOG2073 Eukaryota
ENOG410XRM1 LUCA
GeneTreeiENSGT00390000009899
HOVERGENiHBG069733
InParanoidiQ922D4
KOiK15501
PhylomeDBiQ922D4

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR007587 SAPS
PANTHERiPTHR12634 PTHR12634, 1 hit
PfamiView protein in Pfam
PF04499 SAPS, 2 hits
SUPFAMiSSF48371 SSF48371, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q922D4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFWKFDLHSS SHIDTLLERE DVTLKELMDE EDVLQECKAQ NRKLIEFLLK
60 70 80 90 100
AECLEDLVSF IIEEPPQDMD EKIRYKYPNI SCELLTSDVS QMNDRLGEDE
110 120 130 140 150
SLLMKLYSFL LNESPLNPLL ASFFSKVLSI LISRKPEQIV DFLKKKRDFV
160 170 180 190 200
DLIIKHIGTS AIMDLLLRLL TCIEPPQPRQ DVLNWLNEER IIQRLVEIVH
210 220 230 240 250
PSQEEDRHSN ASQSLCEIVR LSRDQMLQVQ NSTEPDPLLA TLEKQEIIEQ
260 270 280 290 300
LLSNIFHKEK NESAIVSAIQ ILLTLLETRR PTFEGHIEIC PPGMSHSACS
310 320 330 340 350
VNKSVLEAIR GRLGSFHELL LEPPKKSVMK TTWGILDPPV GNTRLNVIRL
360 370 380 390 400
ISSLLQTNTS SINGDLMELN SIGVILDMFF KYTWNNFLHT QVEICIALIL
410 420 430 440 450
ASPFENAENG TITDQDSTGD NLLLKHLFQK CQLIERILEA WDTNEKKQAE
460 470 480 490 500
GGRRHGYMGH LTRIANCIVH STDKGPNSAL VQQLIKDLPD EVRERWETFC
510 520 530 540 550
TNSLGETNKR NTVDLAFSDY QMQQMTSNFI DQFGFNDEKF ADQDDIGNVS
560 570 580 590 600
FDRVSDINFT LNTNESGNIA LFEACCKERI QQFDDGGSDE EDIWEEKHIA
610 620 630 640 650
FTPESQRRSS SGSTDSEEST DSEEEDGAKQ DLFESSSANT EDKMEVDLNE
660 670 680 690 700
PPTWSANFDV PMETTHGAPL DSVGSDVWST EEPMPTKETG WASFSEFTSS
710 720 730 740 750
LSTKESLRSN SPVEMETSTE SVDPLTPGAA ALATQPEAPG SMAMEASSDG
760 770 780 790 800
EEDAESTDKV TETVMNGGMK ETLSLTVDAK TETAVFKSEE EKLSTSQDAA
810 820 830 840
CKDAEETPEP AEAKCTAPLT PSSSPEQRTD QPSMPSDPSV NGPV
Length:844
Mass (Da):94,653
Last modified:December 1, 2001 - v1
Checksum:i1C70ED57ECEF1D45
GO
Isoform 2 (identifier: Q922D4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     516-532: Missing.

Show »
Length:827
Mass (Da):92,617
Checksum:iB0662791EA23E430
GO
Isoform 3 (identifier: Q922D4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     516-548: AFSDYQMQQMTSNFIDQFGFNDEKFADQDDIGN → VTTCHIHSSSDDEIDFKDTGFSQDSSLQQVSHT
     549-844: Missing.

Show »
Length:548
Mass (Da):62,653
Checksum:iF7539F7CDAD9DD16
GO
Isoform 4 (identifier: Q922D4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     487-497: DLPDEVRERWE → GKLVNNLITCV
     498-844: Missing.

Show »
Length:497
Mass (Da):56,753
Checksum:i4014B24F3B130679
GO

Sequence cautioni

The sequence BAC98202 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017148487 – 497DLPDEVRERWE → GKLVNNLITCV in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_017149498 – 844Missing in isoform 4. 1 PublicationAdd BLAST347
Alternative sequenceiVSP_017146516 – 548AFSDY…DDIGN → VTTCHIHSSSDDEIDFKDTG FSQDSSLQQVSHT in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_017145516 – 532Missing in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_017147549 – 844Missing in isoform 3. 1 PublicationAdd BLAST296

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129392 mRNA Translation: BAC98202.1 Different initiation.
AK018652 mRNA Translation: BAB31326.1
AK035236 mRNA Translation: BAC28993.1
AK088526 mRNA Translation: BAC40403.1
BC008529 mRNA Translation: AAH08529.1
CCDSiCCDS29397.1 [Q922D4-1]
CCDS50340.1 [Q922D4-2]
RefSeqiNP_001157631.1, NM_001164159.1 [Q922D4-2]
NP_083275.1, NM_028999.1
NP_083732.1, NM_029456.2 [Q922D4-1]
XP_006531859.1, XM_006531796.1 [Q922D4-2]
UniGeneiMm.284686

Genome annotation databases

EnsembliENSMUST00000025846; ENSMUSP00000025846; ENSMUSG00000024908 [Q922D4-1]
ENSMUST00000172362; ENSMUSP00000131084; ENSMUSG00000024908 [Q922D4-2]
GeneIDi52036
KEGGimmu:52036
UCSCiuc008fwk.3 mouse [Q922D4-1]
uc008fwl.3 mouse [Q922D4-2]
uc008fwm.2 mouse [Q922D4-3]
uc008fwo.2 mouse [Q922D4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPP6R3_MOUSE
AccessioniPrimary (citable) accession number: Q922D4
Secondary accession number(s): Q6ZPM9, Q8BTW6, Q9D2X9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: December 1, 2001
Last modified: May 23, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health