Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bicaudal D homolog 2

Gene

Bicd2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.

GO - Molecular functioni

  • dynein light intermediate chain binding Source: FlyBase
  • Rab GTPase binding Source: BHF-UCL

GO - Biological processi

  • microtubule anchoring at microtubule organizing center Source: BHF-UCL
  • microtubule-based movement Source: MGI
  • minus-end-directed organelle transport along microtubule Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 2
Short name:
Bic-D 2
Gene namesi
Name:Bicd2
Synonyms:Kiaa0699
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1924145. Bicd2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytoplasmic vesicle Source: BHF-UCL
  • cytoskeleton Source: UniProtKB-SubCell
  • Golgi apparatus Source: BHF-UCL
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002053602 – 820Protein bicaudal D homolog 2Add BLAST819

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei190PhosphoserineBy similarity1
Modified residuei224PhosphoserineBy similarity1
Modified residuei320PhosphoserineBy similarity1
Modified residuei321PhosphothreonineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei397PhosphoserineBy similarity1
Modified residuei570PhosphoserineBy similarity1
Modified residuei578PhosphoserineCombined sources1
Modified residuei598PhosphothreonineBy similarity1
Modified residuei819PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by NEK9 in vitro.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ921C5.
PeptideAtlasiQ921C5.
PRIDEiQ921C5.

PTM databases

iPTMnetiQ921C5.
PhosphoSitePlusiQ921C5.

Expressioni

Tissue specificityi

Ubiquitously expressed with high expression in the spinal cord.1 Publication

Gene expression databases

BgeeiENSMUSG00000037933.
CleanExiMM_BICD2.
ExpressionAtlasiQ921C5. baseline and differential.
GenevisibleiQ921C5. MM.

Interactioni

Subunit structurei

Interacts with CPNE4 (via VWFA domain) (PubMed:12522145). Interacts with NEK9. Interacts with DCTN2 and RAB6A. Interacts with DNAI1. Interacts with DYNC1H1 (By similarity).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Rab6aP352793EBI-642984,EBI-444674

GO - Molecular functioni

  • dynein light intermediate chain binding Source: FlyBase
  • Rab GTPase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi218383. 7 interactors.
DIPiDIP-49453N.
IntActiQ921C5. 5 interactors.
MINTiMINT-1572114.
STRINGi10090.ENSMUSP00000039394.

Structurei

3D structure databases

ProteinModelPortaliQ921C5.
SMRiQ921C5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni662 – 804Interaction with RAB6AAdd BLAST143

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili20 – 270Sequence analysisAdd BLAST251
Coiled coili340 – 539Sequence analysisAdd BLAST200
Coiled coili662 – 804Sequence analysisAdd BLAST143

Domaini

The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0999. Eukaryota.
ENOG410XR47. LUCA.
GeneTreeiENSGT00390000004114.
HOGENOMiHOG000261658.
HOVERGENiHBG050686.
InParanoidiQ921C5.
KOiK18739.
OMAiDRDSHED.
OrthoDBiEOG091G01P4.
PhylomeDBiQ921C5.
TreeFamiTF323833.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PfamiPF09730. BicD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q921C5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPSEEEEY ARLVMEAQPE WLRAEVKRLS HELAETTREK IQAAEYGLAV
60 70 80 90 100
LEEKHQLKLQ FEELEVDYEA IRSEMEQLKE AFGQAHTNHK KVAADGESRE
110 120 130 140 150
ESLIQESASK EQYYVRKVLE LQTELKQLRN VLTNTQSENE RLTSVAQELK
160 170 180 190 200
EINQNVEIQR GRLRDDIKEY KFREARLLQD YSELEEENIS LQKQVSVLRQ
210 220 230 240 250
NQVEFEGLKH EIKRLEEETE YLNSQLEDAI RLKEISERQL EEALETLKTE
260 270 280 290 300
REQKNNLRKE LSHYMSINDS FYTSHLQVSL DGLKFSDDTV TAEPNNDAEA
310 320 330 340 350
LVNGFEHSGL VKSSLDNKTS TPRKDGLAPP SPSLVSDLLS ELHISEIQKL
360 370 380 390 400
KQQLVQMERE KVGLLATLQD TQKQLEQARG TLSEQHEKVN RLTENLSALR
410 420 430 440 450
RLQAGKERQT SLDNEKDRDS HEDGDYYEVD INGPEILACK YHVAVAEAGE
460 470 480 490 500
LREQLKALRS THEAREAQHA EEKGRYEAEG QALTEKISLL EKASHQDREL
510 520 530 540 550
LAHLEKELKK VSDVAGETQG SLNVAQDELV TFSEELANLY HHVCMCNNET
560 570 580 590 600
PNRVMLDYYR EGQGKAGRTS PEGRGRRSPV LLPKGLLATE VGRADGGTGD
610 620 630 640 650
NSPSPSSSLP SPLSDPRREP MNIYNLIAII RDQIKHLQAA VDRTTELSRQ
660 670 680 690 700
RIASQELGPA VDKDKEALME EILKLKSLLS TKREQITTLR TVLKANKQTA
710 720 730 740 750
EVALANLKSK YENEKAMVTE TMMKLRNELK ALKEDAATFS SLRAMFATRC
760 770 780 790 800
DEYITQLDEM QRQLAAAEDE KKTLNSLLRM AIQQKLALTQ RLELLELDHE
810 820
QTRRGRSKAA SKAKPASPSL
Length:820
Mass (Da):93,391
Last modified:December 1, 2001 - v1
Checksum:i0C1A1754CD74DDE1
GO
Isoform 2 (identifier: Q921C5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     820-820: L → VSHTCACASERAEGAGLANQVFCSEKHSIYCD

Note: No experimental confirmation available.
Show »
Length:851
Mass (Da):96,647
Checksum:i25A80CD34D97587F
GO
Isoform 3 (identifier: Q921C5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-338: APPSPSLVSDL → VHPLHALCLTV
     339-820: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:338
Mass (Da):39,315
Checksum:iE2DF08B87A283BFE
GO

Sequence cautioni

Isoform 3 : The sequence BAB22282 differs from that shown. Reason: Frameshift at position 70.Curated
The sequence BAC65630 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007971328 – 338APPSPSLVSDL → VHPLHALCLTV in isoform 3. CuratedAdd BLAST11
Alternative sequenceiVSP_007972339 – 820Missing in isoform 3. CuratedAdd BLAST482
Alternative sequenceiVSP_007970820L → VSHTCACASERAEGAGLANQ VFCSEKHSIYCD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250106 mRNA. Translation: CAC51393.1.
AK122348 mRNA. Translation: BAC65630.1. Different initiation.
BC032198 mRNA. Translation: AAH32198.1.
AK002683 mRNA. Translation: BAB22282.1. Frameshift.
AK003456 mRNA. Translation: BAC25035.1.
CCDSiCCDS36656.1. [Q921C5-1]
CCDS36657.1. [Q921C5-2]
RefSeqiNP_001034268.1. NM_001039179.2. [Q921C5-2]
NP_001034269.1. NM_001039180.2.
NP_084067.1. NM_029791.4. [Q921C5-1]
UniGeneiMm.197387.

Genome annotation databases

EnsembliENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933. [Q921C5-2]
ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933. [Q921C5-1]
GeneIDi76895.
KEGGimmu:76895.
UCSCiuc007qjg.2. mouse. [Q921C5-1]
uc007qji.2. mouse. [Q921C5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250106 mRNA. Translation: CAC51393.1.
AK122348 mRNA. Translation: BAC65630.1. Different initiation.
BC032198 mRNA. Translation: AAH32198.1.
AK002683 mRNA. Translation: BAB22282.1. Frameshift.
AK003456 mRNA. Translation: BAC25035.1.
CCDSiCCDS36656.1. [Q921C5-1]
CCDS36657.1. [Q921C5-2]
RefSeqiNP_001034268.1. NM_001039179.2. [Q921C5-2]
NP_001034269.1. NM_001039180.2.
NP_084067.1. NM_029791.4. [Q921C5-1]
UniGeneiMm.197387.

3D structure databases

ProteinModelPortaliQ921C5.
SMRiQ921C5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi218383. 7 interactors.
DIPiDIP-49453N.
IntActiQ921C5. 5 interactors.
MINTiMINT-1572114.
STRINGi10090.ENSMUSP00000039394.

PTM databases

iPTMnetiQ921C5.
PhosphoSitePlusiQ921C5.

Proteomic databases

PaxDbiQ921C5.
PeptideAtlasiQ921C5.
PRIDEiQ921C5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933. [Q921C5-2]
ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933. [Q921C5-1]
GeneIDi76895.
KEGGimmu:76895.
UCSCiuc007qjg.2. mouse. [Q921C5-1]
uc007qji.2. mouse. [Q921C5-2]

Organism-specific databases

CTDi23299.
MGIiMGI:1924145. Bicd2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0999. Eukaryota.
ENOG410XR47. LUCA.
GeneTreeiENSGT00390000004114.
HOGENOMiHOG000261658.
HOVERGENiHBG050686.
InParanoidiQ921C5.
KOiK18739.
OMAiDRDSHED.
OrthoDBiEOG091G01P4.
PhylomeDBiQ921C5.
TreeFamiTF323833.

Miscellaneous databases

ChiTaRSiBicd2. mouse.
PROiQ921C5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037933.
CleanExiMM_BICD2.
ExpressionAtlasiQ921C5. baseline and differential.
GenevisibleiQ921C5. MM.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PfamiPF09730. BicD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBICD2_MOUSE
AccessioniPrimary (citable) accession number: Q921C5
Secondary accession number(s): Q80TU1, Q8BTE3, Q9DCL3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.