Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q921C5

- BICD2_MOUSE

UniProt

Q921C5 - BICD2_MOUSE

Protein

Protein bicaudal D homolog 2

Gene

Bicd2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. Rab GTPase binding Source: BHF-UCL

    GO - Biological processi

    1. microtubule anchoring at microtubule organizing center Source: BHF-UCL
    2. microtubule-based movement Source: MGI
    3. minus-end-directed organelle transport along microtubule Source: BHF-UCL

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein bicaudal D homolog 2
    Short name:
    Bic-D 2
    Gene namesi
    Name:Bicd2
    Synonyms:Kiaa0699
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:1924145. Bicd2.

    Subcellular locationi

    Golgi apparatus. Cytoplasmcytoskeleton
    Note: In interphase cells mainly localizes to the Golgi complex and colocalizes with dynactin at microtubule plus ends.

    GO - Cellular componenti

    1. cytoplasmic vesicle Source: BHF-UCL
    2. cytoskeleton Source: UniProtKB-SubCell
    3. Golgi apparatus Source: BHF-UCL
    4. plasma membrane Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Golgi apparatus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 820819Protein bicaudal D homolog 2PRO_0000205360Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserineBy similarity
    Modified residuei190 – 1901PhosphoserineBy similarity
    Modified residuei224 – 2241PhosphoserineBy similarity
    Modified residuei345 – 3451PhosphoserineBy similarity
    Modified residuei397 – 3971PhosphoserineBy similarity
    Modified residuei578 – 5781PhosphoserineBy similarity
    Modified residuei819 – 8191PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylated by NEK9 in vitro.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ921C5.
    PaxDbiQ921C5.
    PRIDEiQ921C5.

    PTM databases

    PhosphoSiteiQ921C5.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed with high expression in the spinal cord.1 Publication

    Gene expression databases

    ArrayExpressiQ921C5.
    BgeeiQ921C5.
    CleanExiMM_BICD2.
    GenevestigatoriQ921C5.

    Interactioni

    Subunit structurei

    Interacts with NEK9 By similarity. Interacts with DCTN2 and RAB6A. Interacs with DNAI1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Rab6aP352793EBI-642984,EBI-444674

    Protein-protein interaction databases

    BioGridi218383. 1 interaction.
    DIPiDIP-49453N.
    IntActiQ921C5. 4 interactions.
    MINTiMINT-1572114.

    Structurei

    3D structure databases

    ProteinModelPortaliQ921C5.
    SMRiQ921C5. Positions 712-793.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni662 – 804143Interacts with RAB6AAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili20 – 270251Sequence AnalysisAdd
    BLAST
    Coiled coili340 – 539200Sequence AnalysisAdd
    BLAST
    Coiled coili662 – 804143Sequence AnalysisAdd
    BLAST

    Domaini

    The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.

    Sequence similaritiesi

    Belongs to the BicD family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG291306.
    GeneTreeiENSGT00390000004114.
    HOGENOMiHOG000261658.
    HOVERGENiHBG050686.
    OMAiRNVLTNT.
    OrthoDBiEOG7BZVRK.
    PhylomeDBiQ921C5.
    TreeFamiTF323833.

    Family and domain databases

    InterProiIPR018477. Bicaudal-D_microtubule-assoc.
    [Graphical view]
    PANTHERiPTHR31233. PTHR31233. 1 hit.
    PfamiPF09730. BicD. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q921C5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAPSEEEEY ARLVMEAQPE WLRAEVKRLS HELAETTREK IQAAEYGLAV    50
    LEEKHQLKLQ FEELEVDYEA IRSEMEQLKE AFGQAHTNHK KVAADGESRE 100
    ESLIQESASK EQYYVRKVLE LQTELKQLRN VLTNTQSENE RLTSVAQELK 150
    EINQNVEIQR GRLRDDIKEY KFREARLLQD YSELEEENIS LQKQVSVLRQ 200
    NQVEFEGLKH EIKRLEEETE YLNSQLEDAI RLKEISERQL EEALETLKTE 250
    REQKNNLRKE LSHYMSINDS FYTSHLQVSL DGLKFSDDTV TAEPNNDAEA 300
    LVNGFEHSGL VKSSLDNKTS TPRKDGLAPP SPSLVSDLLS ELHISEIQKL 350
    KQQLVQMERE KVGLLATLQD TQKQLEQARG TLSEQHEKVN RLTENLSALR 400
    RLQAGKERQT SLDNEKDRDS HEDGDYYEVD INGPEILACK YHVAVAEAGE 450
    LREQLKALRS THEAREAQHA EEKGRYEAEG QALTEKISLL EKASHQDREL 500
    LAHLEKELKK VSDVAGETQG SLNVAQDELV TFSEELANLY HHVCMCNNET 550
    PNRVMLDYYR EGQGKAGRTS PEGRGRRSPV LLPKGLLATE VGRADGGTGD 600
    NSPSPSSSLP SPLSDPRREP MNIYNLIAII RDQIKHLQAA VDRTTELSRQ 650
    RIASQELGPA VDKDKEALME EILKLKSLLS TKREQITTLR TVLKANKQTA 700
    EVALANLKSK YENEKAMVTE TMMKLRNELK ALKEDAATFS SLRAMFATRC 750
    DEYITQLDEM QRQLAAAEDE KKTLNSLLRM AIQQKLALTQ RLELLELDHE 800
    QTRRGRSKAA SKAKPASPSL 820
    Length:820
    Mass (Da):93,391
    Last modified:December 1, 2001 - v1
    Checksum:i0C1A1754CD74DDE1
    GO
    Isoform 2 (identifier: Q921C5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         820-820: L → VSHTCACASERAEGAGLANQVFCSEKHSIYCD

    Note: No experimental confirmation available.

    Show »
    Length:851
    Mass (Da):96,647
    Checksum:i25A80CD34D97587F
    GO
    Isoform 3 (identifier: Q921C5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-338: APPSPSLVSDL → VHPLHALCLTV
         339-820: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:338
    Mass (Da):39,315
    Checksum:iE2DF08B87A283BFE
    GO

    Sequence cautioni

    Isoform 3 : The sequence BAB22282.1 differs from that shown. Reason: Frameshift at position 70.
    The sequence BAC65630.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei328 – 33811APPSPSLVSDL → VHPLHALCLTV in isoform 3. CuratedVSP_007971Add
    BLAST
    Alternative sequencei339 – 820482Missing in isoform 3. CuratedVSP_007972Add
    BLAST
    Alternative sequencei820 – 8201L → VSHTCACASERAEGAGLANQ VFCSEKHSIYCD in isoform 2. 1 PublicationVSP_007970

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ250106 mRNA. Translation: CAC51393.1.
    AK122348 mRNA. Translation: BAC65630.1. Different initiation.
    BC032198 mRNA. Translation: AAH32198.1.
    AK002683 mRNA. Translation: BAB22282.1. Frameshift.
    AK003456 mRNA. Translation: BAC25035.1.
    CCDSiCCDS36656.1. [Q921C5-1]
    CCDS36657.1. [Q921C5-2]
    RefSeqiNP_001034268.1. NM_001039179.2. [Q921C5-2]
    NP_001034269.1. NM_001039180.2.
    NP_084067.1. NM_029791.4. [Q921C5-1]
    UniGeneiMm.197387.

    Genome annotation databases

    EnsembliENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933. [Q921C5-2]
    ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933. [Q921C5-1]
    GeneIDi76895.
    KEGGimmu:76895.
    UCSCiuc007qjg.1. mouse. [Q921C5-1]
    uc007qji.1. mouse. [Q921C5-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ250106 mRNA. Translation: CAC51393.1 .
    AK122348 mRNA. Translation: BAC65630.1 . Different initiation.
    BC032198 mRNA. Translation: AAH32198.1 .
    AK002683 mRNA. Translation: BAB22282.1 . Frameshift.
    AK003456 mRNA. Translation: BAC25035.1 .
    CCDSi CCDS36656.1. [Q921C5-1 ]
    CCDS36657.1. [Q921C5-2 ]
    RefSeqi NP_001034268.1. NM_001039179.2. [Q921C5-2 ]
    NP_001034269.1. NM_001039180.2.
    NP_084067.1. NM_029791.4. [Q921C5-1 ]
    UniGenei Mm.197387.

    3D structure databases

    ProteinModelPortali Q921C5.
    SMRi Q921C5. Positions 712-793.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 218383. 1 interaction.
    DIPi DIP-49453N.
    IntActi Q921C5. 4 interactions.
    MINTi MINT-1572114.

    PTM databases

    PhosphoSitei Q921C5.

    Proteomic databases

    MaxQBi Q921C5.
    PaxDbi Q921C5.
    PRIDEi Q921C5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000048544 ; ENSMUSP00000039394 ; ENSMUSG00000037933 . [Q921C5-2 ]
    ENSMUST00000110085 ; ENSMUSP00000105712 ; ENSMUSG00000037933 . [Q921C5-1 ]
    GeneIDi 76895.
    KEGGi mmu:76895.
    UCSCi uc007qjg.1. mouse. [Q921C5-1 ]
    uc007qji.1. mouse. [Q921C5-2 ]

    Organism-specific databases

    CTDi 23299.
    MGIi MGI:1924145. Bicd2.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG291306.
    GeneTreei ENSGT00390000004114.
    HOGENOMi HOG000261658.
    HOVERGENi HBG050686.
    OMAi RNVLTNT.
    OrthoDBi EOG7BZVRK.
    PhylomeDBi Q921C5.
    TreeFami TF323833.

    Miscellaneous databases

    NextBioi 346027.
    PROi Q921C5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q921C5.
    Bgeei Q921C5.
    CleanExi MM_BICD2.
    Genevestigatori Q921C5.

    Family and domain databases

    InterProi IPR018477. Bicaudal-D_microtubule-assoc.
    [Graphical view ]
    PANTHERi PTHR31233. PTHR31233. 1 hit.
    Pfami PF09730. BicD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mammalian Golgi-associated Bicaudal-D2 functions in the dynein-dynactin pathway by interacting with these complexes."
      Hoogenraad C.C., Akhmanova A., Howell S.A., Dortland B.R., de Zeeuw C.I., Willemsen R., Visser P., Grosveld F., Galjart N.
      EMBO J. 20:4041-4054(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary tumor.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: C57BL/6J.
      Tissue: Embryo and Kidney.
    5. "Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex."
      Matanis T., Akhmanova A., Wulf P., Del Nery E., Weide T., Stepanova T., Galjart N., Grosveld F., Goud B., De Zeeuw C.I., Barnekow A., Hoogenraad C.C.
      Nat. Cell Biol. 4:986-992(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    6. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.
    7. "Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance."
      Peeters K., Litvinenko I., Asselbergh B., Almeida-Souza L., Chamova T., Geuens T., Ydens E., Zimon M., Irobi J., De Vriendt E., De Winter V., Ooms T., Timmerman V., Tournev I., Jordanova A.
      Am. J. Hum. Genet. 92:955-964(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiBICD2_MOUSE
    AccessioniPrimary (citable) accession number: Q921C5
    Secondary accession number(s): Q80TU1, Q8BTE3, Q9DCL3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 15, 2003
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3