Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q921C5

- BICD2_MOUSE

UniProt

Q921C5 - BICD2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein bicaudal D homolog 2

Gene

Bicd2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.

GO - Molecular functioni

  1. Rab GTPase binding Source: BHF-UCL

GO - Biological processi

  1. microtubule anchoring at microtubule organizing center Source: BHF-UCL
  2. microtubule-based movement Source: MGI
  3. minus-end-directed organelle transport along microtubule Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 2
Short name:
Bic-D 2
Gene namesi
Name:Bicd2
Synonyms:Kiaa0699
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:1924145. Bicd2.

Subcellular locationi

Golgi apparatus. Cytoplasmcytoskeleton
Note: In interphase cells mainly localizes to the Golgi complex and colocalizes with dynactin at microtubule plus ends.

GO - Cellular componenti

  1. cytoplasmic vesicle Source: BHF-UCL
  2. cytoskeleton Source: UniProtKB-KW
  3. Golgi apparatus Source: BHF-UCL
  4. plasma membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 820819Protein bicaudal D homolog 2PRO_0000205360Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei190 – 1901PhosphoserineBy similarity
Modified residuei224 – 2241PhosphoserineBy similarity
Modified residuei345 – 3451PhosphoserineBy similarity
Modified residuei397 – 3971PhosphoserineBy similarity
Modified residuei578 – 5781PhosphoserineBy similarity
Modified residuei819 – 8191PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated by NEK9 in vitro.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ921C5.
PaxDbiQ921C5.
PRIDEiQ921C5.

PTM databases

PhosphoSiteiQ921C5.

Expressioni

Tissue specificityi

Ubiquitously expressed with high expression in the spinal cord.1 Publication

Gene expression databases

BgeeiQ921C5.
CleanExiMM_BICD2.
ExpressionAtlasiQ921C5. baseline and differential.
GenevestigatoriQ921C5.

Interactioni

Subunit structurei

Interacts with NEK9 (By similarity). Interacts with DCTN2 and RAB6A. Interacs with DNAI1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Rab6aP352793EBI-642984,EBI-444674

Protein-protein interaction databases

BioGridi218383. 6 interactions.
DIPiDIP-49453N.
IntActiQ921C5. 4 interactions.
MINTiMINT-1572114.

Structurei

3D structure databases

ProteinModelPortaliQ921C5.
SMRiQ921C5. Positions 712-793.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni662 – 804143Interacts with RAB6AAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili20 – 270251Sequence AnalysisAdd
BLAST
Coiled coili340 – 539200Sequence AnalysisAdd
BLAST
Coiled coili662 – 804143Sequence AnalysisAdd
BLAST

Domaini

The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG291306.
GeneTreeiENSGT00390000004114.
HOGENOMiHOG000261658.
HOVERGENiHBG050686.
InParanoidiQ921C5.
OMAiRNVLTNT.
OrthoDBiEOG7BZVRK.
PhylomeDBiQ921C5.
TreeFamiTF323833.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PANTHERiPTHR31233. PTHR31233. 1 hit.
PfamiPF09730. BicD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q921C5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPSEEEEY ARLVMEAQPE WLRAEVKRLS HELAETTREK IQAAEYGLAV
60 70 80 90 100
LEEKHQLKLQ FEELEVDYEA IRSEMEQLKE AFGQAHTNHK KVAADGESRE
110 120 130 140 150
ESLIQESASK EQYYVRKVLE LQTELKQLRN VLTNTQSENE RLTSVAQELK
160 170 180 190 200
EINQNVEIQR GRLRDDIKEY KFREARLLQD YSELEEENIS LQKQVSVLRQ
210 220 230 240 250
NQVEFEGLKH EIKRLEEETE YLNSQLEDAI RLKEISERQL EEALETLKTE
260 270 280 290 300
REQKNNLRKE LSHYMSINDS FYTSHLQVSL DGLKFSDDTV TAEPNNDAEA
310 320 330 340 350
LVNGFEHSGL VKSSLDNKTS TPRKDGLAPP SPSLVSDLLS ELHISEIQKL
360 370 380 390 400
KQQLVQMERE KVGLLATLQD TQKQLEQARG TLSEQHEKVN RLTENLSALR
410 420 430 440 450
RLQAGKERQT SLDNEKDRDS HEDGDYYEVD INGPEILACK YHVAVAEAGE
460 470 480 490 500
LREQLKALRS THEAREAQHA EEKGRYEAEG QALTEKISLL EKASHQDREL
510 520 530 540 550
LAHLEKELKK VSDVAGETQG SLNVAQDELV TFSEELANLY HHVCMCNNET
560 570 580 590 600
PNRVMLDYYR EGQGKAGRTS PEGRGRRSPV LLPKGLLATE VGRADGGTGD
610 620 630 640 650
NSPSPSSSLP SPLSDPRREP MNIYNLIAII RDQIKHLQAA VDRTTELSRQ
660 670 680 690 700
RIASQELGPA VDKDKEALME EILKLKSLLS TKREQITTLR TVLKANKQTA
710 720 730 740 750
EVALANLKSK YENEKAMVTE TMMKLRNELK ALKEDAATFS SLRAMFATRC
760 770 780 790 800
DEYITQLDEM QRQLAAAEDE KKTLNSLLRM AIQQKLALTQ RLELLELDHE
810 820
QTRRGRSKAA SKAKPASPSL
Length:820
Mass (Da):93,391
Last modified:December 1, 2001 - v1
Checksum:i0C1A1754CD74DDE1
GO
Isoform 2 (identifier: Q921C5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     820-820: L → VSHTCACASERAEGAGLANQVFCSEKHSIYCD

Note: No experimental confirmation available.

Show »
Length:851
Mass (Da):96,647
Checksum:i25A80CD34D97587F
GO
Isoform 3 (identifier: Q921C5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-338: APPSPSLVSDL → VHPLHALCLTV
     339-820: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:338
Mass (Da):39,315
Checksum:iE2DF08B87A283BFE
GO

Sequence cautioni

Isoform 3 : The sequence BAB22282.1 differs from that shown. Reason: Frameshift at position 70.
The sequence BAC65630.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei328 – 33811APPSPSLVSDL → VHPLHALCLTV in isoform 3. CuratedVSP_007971Add
BLAST
Alternative sequencei339 – 820482Missing in isoform 3. CuratedVSP_007972Add
BLAST
Alternative sequencei820 – 8201L → VSHTCACASERAEGAGLANQ VFCSEKHSIYCD in isoform 2. 1 PublicationVSP_007970

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ250106 mRNA. Translation: CAC51393.1.
AK122348 mRNA. Translation: BAC65630.1. Different initiation.
BC032198 mRNA. Translation: AAH32198.1.
AK002683 mRNA. Translation: BAB22282.1. Frameshift.
AK003456 mRNA. Translation: BAC25035.1.
CCDSiCCDS36656.1. [Q921C5-1]
CCDS36657.1. [Q921C5-2]
RefSeqiNP_001034268.1. NM_001039179.2. [Q921C5-2]
NP_001034269.1. NM_001039180.2.
NP_084067.1. NM_029791.4. [Q921C5-1]
UniGeneiMm.197387.

Genome annotation databases

EnsembliENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933. [Q921C5-2]
ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933. [Q921C5-1]
GeneIDi76895.
KEGGimmu:76895.
UCSCiuc007qjg.1. mouse. [Q921C5-1]
uc007qji.1. mouse. [Q921C5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ250106 mRNA. Translation: CAC51393.1 .
AK122348 mRNA. Translation: BAC65630.1 . Different initiation.
BC032198 mRNA. Translation: AAH32198.1 .
AK002683 mRNA. Translation: BAB22282.1 . Frameshift.
AK003456 mRNA. Translation: BAC25035.1 .
CCDSi CCDS36656.1. [Q921C5-1 ]
CCDS36657.1. [Q921C5-2 ]
RefSeqi NP_001034268.1. NM_001039179.2. [Q921C5-2 ]
NP_001034269.1. NM_001039180.2.
NP_084067.1. NM_029791.4. [Q921C5-1 ]
UniGenei Mm.197387.

3D structure databases

ProteinModelPortali Q921C5.
SMRi Q921C5. Positions 712-793.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 218383. 6 interactions.
DIPi DIP-49453N.
IntActi Q921C5. 4 interactions.
MINTi MINT-1572114.

PTM databases

PhosphoSitei Q921C5.

Proteomic databases

MaxQBi Q921C5.
PaxDbi Q921C5.
PRIDEi Q921C5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000048544 ; ENSMUSP00000039394 ; ENSMUSG00000037933 . [Q921C5-2 ]
ENSMUST00000110085 ; ENSMUSP00000105712 ; ENSMUSG00000037933 . [Q921C5-1 ]
GeneIDi 76895.
KEGGi mmu:76895.
UCSCi uc007qjg.1. mouse. [Q921C5-1 ]
uc007qji.1. mouse. [Q921C5-2 ]

Organism-specific databases

CTDi 23299.
MGIi MGI:1924145. Bicd2.
Rougei Search...

Phylogenomic databases

eggNOGi NOG291306.
GeneTreei ENSGT00390000004114.
HOGENOMi HOG000261658.
HOVERGENi HBG050686.
InParanoidi Q921C5.
OMAi RNVLTNT.
OrthoDBi EOG7BZVRK.
PhylomeDBi Q921C5.
TreeFami TF323833.

Miscellaneous databases

NextBioi 346027.
PROi Q921C5.
SOURCEi Search...

Gene expression databases

Bgeei Q921C5.
CleanExi MM_BICD2.
ExpressionAtlasi Q921C5. baseline and differential.
Genevestigatori Q921C5.

Family and domain databases

InterProi IPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view ]
PANTHERi PTHR31233. PTHR31233. 1 hit.
Pfami PF09730. BicD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Mammalian Golgi-associated Bicaudal-D2 functions in the dynein-dynactin pathway by interacting with these complexes."
    Hoogenraad C.C., Akhmanova A., Howell S.A., Dortland B.R., de Zeeuw C.I., Willemsen R., Visser P., Grosveld F., Galjart N.
    EMBO J. 20:4041-4054(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary tumor.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J.
    Tissue: Embryo and Kidney.
  5. "Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex."
    Matanis T., Akhmanova A., Wulf P., Del Nery E., Weide T., Stepanova T., Galjart N., Grosveld F., Goud B., De Zeeuw C.I., Barnekow A., Hoogenraad C.C.
    Nat. Cell Biol. 4:986-992(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  6. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.
  7. "Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance."
    Peeters K., Litvinenko I., Asselbergh B., Almeida-Souza L., Chamova T., Geuens T., Ydens E., Zimon M., Irobi J., De Vriendt E., De Winter V., Ooms T., Timmerman V., Tournev I., Jordanova A.
    Am. J. Hum. Genet. 92:955-964(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiBICD2_MOUSE
AccessioniPrimary (citable) accession number: Q921C5
Secondary accession number(s): Q80TU1, Q8BTE3, Q9DCL3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3