Q921C5 (BICD2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein bicaudal D homolog 2 Short name=Bic-D 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 820 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex. |
| Subunit structure | Interacts with NEK9 By similarity. Interacts with DCTN2 and RAB6A. |
| Subcellular location | Golgi apparatus. Cytoplasm › cytoskeleton. Note: In interphase cells mainly localizes to the Golgi complex and colocalizes with dynactin at microtubule plus ends. |
| Domain | The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2. |
| Post-translational modification | Phosphorylated by NEK9 in vitro By similarity. |
| Sequence similarities | Belongs to the BicD family. |
| Sequence caution | The sequence BAC65630.1 differs from that shown. Reason: Erroneous initiation. Isoform 3: The sequence BAB22282.1 differs from that shown. Reason: Frameshift at position 70. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Golgi apparatus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | microtubule anchoring at microtubule organizing center Inferred from mutant phenotype PubMed 19825938. Source: BHF-UCL minus-end-directed organelle transport along microtubuleInferred from mutant phenotype Ref.5. Source: BHF-UCL |
| Cellular_component | Golgi apparatus Inferred from direct assay Ref.5. Source: BHF-UCL cytoplasmic vesicleInferred from direct assay Ref.5. Source: BHF-UCL cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q921C5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q921C5-2) The sequence of this isoform differs from the canonical sequence as follows: 820-820: L → VSHTCACASERAEGAGLANQVFCSEKHSIYCD | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q921C5-3) The sequence of this isoform differs from the canonical sequence as follows: 328-338: APPSPSLVSDL → VHPLHALCLTV 339-820: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 820 | 820 | Protein bicaudal D homolog 2 | PRO_0000205360 | |||||
Regions | |||||||||
| Region | 662 – 804 | 143 | Interacts with RAB6A | ||||||
| Coiled coil | 20 – 270 | 251 | Potential | ||||||
| Coiled coil | 340 – 539 | 200 | Potential | ||||||
| Coiled coil | 662 – 804 | 143 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 190 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 224 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 345 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 397 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 578 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 819 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 328 – 338 | 11 | APPSPSLVSDL → VHPLHALCLTV in isoform 3. | VSP_007971 | |||||
| Alternative sequence | 339 – 820 | 482 | Missing in isoform 3. | VSP_007972 | |||||
| Alternative sequence | 820 | 1 | L → VSHTCACASERAEGAGLANQ VFCSEKHSIYCD in isoform 2. | VSP_007970 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian Golgi-associated Bicaudal-D2 functions in the dynein-dynactin pathway by interacting with these complexes." Hoogenraad C.C., Akhmanova A., Howell S.A., Dortland B.R., de Zeeuw C.I., Willemsen R., Visser P., Grosveld F., Galjart N. EMBO J. 20:4041-4054(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary tumor. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: C57BL/6J. Tissue: Embryo and Kidney. |
| [5] | "Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex." Matanis T., Akhmanova A., Wulf P., Del Nery E., Weide T., Stepanova T., Galjart N., Grosveld F., Goud B., De Zeeuw C.I., Barnekow A., Hoogenraad C.C. Nat. Cell Biol. 4:986-992(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ250106 mRNA. Translation: CAC51393.1. AK122348 mRNA. Translation: BAC65630.1. Different initiation. BC032198 mRNA. Translation: AAH32198.1. AK002683 mRNA. Translation: BAB22282.1. Frameshift. AK003456 mRNA. Translation: BAC25035.1. |
| IPI | IPI00267492. IPI00274647. IPI00338578. |
| RefSeq | NP_001034268.1. NM_001039179.1. NP_001034269.1. NM_001039180.1. NP_084067.1. NM_029791.3. |
| UniGene | Mm.197387. |
3D structure databases | |
| ProteinModelPortal | Q921C5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-49453N. |
| IntAct | Q921C5. 1 interaction. |
PTM databases | |
| PhosphoSite | Q921C5. |
Proteomic databases | |
| PaxDb | Q921C5. |
| PRIDE | Q921C5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933. ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933. |
| GeneID | 76895. |
| KEGG | mmu:76895. |
| UCSC | uc007qjg.1. mouse. uc007qji.1. mouse. |
Organism-specific databases | |
| CTD | 23299. |
| MGI | MGI:1924145. Bicd2. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG291306. |
| GeneTree | ENSGT00390000004114. |
| HOGENOM | HOG000261658. |
| HOVERGEN | HBG050686. |
| OMA | SHTCACA. |
| OrthoDB | EOG4G4GPX. |
Gene expression databases | |
| ArrayExpress | Q921C5. |
| Bgee | Q921C5. |
| CleanEx | MM_BICD2. |
| Genevestigator | Q921C5. |
| GermOnline | ENSMUSG00000037933. Mus musculus. |
Family and domain databases | |
| InterPro | IPR018477. Bicaudal-D_microtubule-assoc. [Graphical view] |
| PANTHER | PTHR31233. PTHR31233. 1 hit. |
| Pfam | PF09730. BicD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 346027. |
| SOURCE | Search... |
Entry information
| Entry name | BICD2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q921C5 Secondary accession number(s): Q80TU1, Q8BTE3, Q9DCL3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
