Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Secretoglobin family 3A member 2

Gene

Scgb3a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

ReactomeiR-MMU-3000480. Scavenging by Class A Receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Secretoglobin family 3A member 2
Alternative name(s):
Pneumo secretory protein 1
Short name:
PnSP-1
Uteroglobin-related protein 1
Gene namesi
Name:Scgb3a2
Synonyms:Pnsp1, Ugrp1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:2153470. Scgb3a2.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000003638222 – 139Secretoglobin family 3A member 2Add BLAST118

Proteomic databases

PaxDbiQ920H1.
PRIDEiQ920H1.

PTM databases

PhosphoSitePlusiQ920H1.

Expressioni

Tissue specificityi

Highly expressed in lung.

Gene expression databases

BgeeiENSMUSG00000038791.
CleanExiMM_SCGB3A2.
ExpressionAtlasiQ920H1. baseline and differential.
GenevisibleiQ920H1. MM.

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000038872.

Structurei

3D structure databases

ProteinModelPortaliQ920H1.
SMRiQ920H1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the secretoglobin family. UGRP subfamily.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J1Y3. Eukaryota.
ENOG4111402. LUCA.
GeneTreeiENSGT00420000029848.
HOGENOMiHOG000128185.
InParanoidiQ920H1.
OrthoDBiEOG091G10V3.
PhylomeDBiQ920H1.
TreeFamiTF336928.

Family and domain databases

InterProiIPR016126. Secretoglobin.
[Graphical view]
PfamiPF01099. Uteroglobin. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform C (identifier: Q920H1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLVSIFLLV TIGICGYSAT ALLINRLPVV DKLPVPLDDI IPSFDPLKML
60 70 80 90 100
LKTLGISVEH LVTGLKKCVD ELGPEASEAV KKLLVIIICS YFPGRSLCYV
110 120 130
NNLPSFVSVL FLPMICAYPR DSKKQTFAFI ERVFEQSKL
Length:139
Mass (Da):15,432
Last modified:December 1, 2001 - v1
Checksum:i8A2FB080B41E65E4
GO
Isoform A (identifier: Q920H1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-91: VIIICSY → EALSHLV
     92-139: Missing.

Show »
Length:91
Mass (Da):9,819
Checksum:i2B5C4D39E6A4EE14
GO
Isoform B (identifier: Q920H1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-139: VSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL → EALSHLV

Show »
Length:113
Mass (Da):12,307
Checksum:iC25213F9BCB96F16
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00672785 – 91VIIICSY → EALSHLV in isoform A. 2 Publications7
Alternative sequenceiVSP_00672892 – 139Missing in isoform A. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_006726107 – 139VSVLF…EQSKL → EALSHLV in isoform B. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274959 mRNA. Translation: AAL25708.1.
AF274960 mRNA. Translation: AAL25709.1.
AF274961 mRNA. Translation: AAL25710.1.
AF439546 mRNA. Translation: AAQ04561.1.
CCDSiCCDS79640.1. [Q920H1-2]
CCDS79641.1. [Q920H1-3]
RefSeqiNP_001276572.1. NM_001289643.1. [Q920H1-3]
NP_001276573.1. NM_001289644.1. [Q920H1-2]
XP_011245113.1. XM_011246811.1. [Q920H1-1]
UniGeneiMm.210437.

Genome annotation databases

EnsembliENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791. [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791. [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791. [Q920H1-3]
GeneIDi117158.
KEGGimmu:117158.
UCSCiuc008eum.2. mouse. [Q920H1-1]
uc012bck.2. mouse. [Q920H1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274959 mRNA. Translation: AAL25708.1.
AF274960 mRNA. Translation: AAL25709.1.
AF274961 mRNA. Translation: AAL25710.1.
AF439546 mRNA. Translation: AAQ04561.1.
CCDSiCCDS79640.1. [Q920H1-2]
CCDS79641.1. [Q920H1-3]
RefSeqiNP_001276572.1. NM_001289643.1. [Q920H1-3]
NP_001276573.1. NM_001289644.1. [Q920H1-2]
XP_011245113.1. XM_011246811.1. [Q920H1-1]
UniGeneiMm.210437.

3D structure databases

ProteinModelPortaliQ920H1.
SMRiQ920H1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000038872.

PTM databases

PhosphoSitePlusiQ920H1.

Proteomic databases

PaxDbiQ920H1.
PRIDEiQ920H1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791. [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791. [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791. [Q920H1-3]
GeneIDi117158.
KEGGimmu:117158.
UCSCiuc008eum.2. mouse. [Q920H1-1]
uc012bck.2. mouse. [Q920H1-3]

Organism-specific databases

CTDi117156.
MGIiMGI:2153470. Scgb3a2.

Phylogenomic databases

eggNOGiENOG410J1Y3. Eukaryota.
ENOG4111402. LUCA.
GeneTreeiENSGT00420000029848.
HOGENOMiHOG000128185.
InParanoidiQ920H1.
OrthoDBiEOG091G10V3.
PhylomeDBiQ920H1.
TreeFamiTF336928.

Enzyme and pathway databases

ReactomeiR-MMU-3000480. Scavenging by Class A Receptors.

Miscellaneous databases

PROiQ920H1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038791.
CleanExiMM_SCGB3A2.
ExpressionAtlasiQ920H1. baseline and differential.
GenevisibleiQ920H1. MM.

Family and domain databases

InterProiIPR016126. Secretoglobin.
[Graphical view]
PfamiPF01099. Uteroglobin. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSG3A2_MOUSE
AccessioniPrimary (citable) accession number: Q920H1
Secondary accession number(s): Q920H2, Q920H3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.